Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.03
PubTator Score 5.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 8.07062779170651E-13
ovarian cancer 8492 3.64887339023677E-12
atypical teratoid / rhabdoid tumor 4369 9.55421749418141E-9
pilocytic astrocytoma 3086 2.08339921212212E-8
glioblastoma 5572 4.5548696735091E-7
medulloblastoma, large-cell 6234 2.18043643029257E-6
adult high grade glioma 2148 4.79121879357139E-6
group 4 medulloblastoma 1875 2.83471713856889E-5
primitive neuroectodermal tumor 3031 1.81955575117552E-4
subependymal giant cell astrocytoma 2287 0.0221177445396936
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 3.316 1.7

Expression

  Differential Expression (10)

Synonym

Accession Q9HCQ5 Q52LR8 Q6NT54 Q8NFR1
Symbols GALNACT9
GALNAC-T9

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
23136245 GALNT9 expression correlates with both improved overall survival in low- and high-risk groups and an improved clinical outcome (overall and disease-free survival) in low-risk patients

AA Sequence

MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGTLGDREAILQRLDHL      1 - 70
EEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDDGQEAEGKYEEYGYNAQLSDRISLDRSIPDYRPRK     71 - 140
CRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVELKFNLDQYVNKRY    141 - 210
PGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYS    211 - 280
TFEVQQYANAAHGYNWGLRCMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYG    281 - 350
GENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM    351 - 420
SNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAIL    421 - 490
YPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGTGRMPTLKKCEDVARPTQRLWDFTQSGPIV    491 - 560
SRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHARH                               561 - 603
//

Text Mined References (9)

PMID Year Title
23136245 2013 GALNT9 gene expression is a prognostic marker in neuroblastoma patients.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12407114 2003 Cloning and characterization of a new human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, designated pp-GalNAc-T13, that is specifically expressed in neurons and synthesizes GalNAc alpha-serine/threonine antigen.
10978536 2000 Brain-specific expression of a novel human UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T9).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.