Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.36
PubTator Score 5.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.900 4.8e-06
Astrocytoma, Pilocytic -1.700 4.0e-08
atypical teratoid / rhabdoid tumor -1.900 9.6e-09
ependymoma -1.300 1.8e-05
glioblastoma -1.500 4.6e-08
group 4 medulloblastoma -1.400 2.8e-05
medulloblastoma, large-cell -1.900 2.2e-06
ovarian cancer -1.500 3.6e-12
primitive neuroectodermal tumor -1.600 1.8e-04
subependymal giant cell astrocytoma -1.217 2.2e-02

Gene RIF (1)

AA Sequence

MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGTLGDREAILQRLDHL      1 - 70
EEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDDGQEAEGKYEEYGYNAQLSDRISLDRSIPDYRPRK     71 - 140
CRQMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVELKFNLDQYVNKRY    141 - 210
PGLVKIVRNSRREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYS    211 - 280
TFEVQQYANAAHGYNWGLRCMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYG    281 - 350
GENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM    351 - 420
SNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASAYCLDQGAEDGDRAIL    421 - 490
YPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGTGRMPTLKKCEDVARPTQRLWDFTQSGPIV    491 - 560
SRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKHARH                               561 - 603
//

Text Mined References (9)

PMID Year Title