Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.22
PubTator Score 4.86

Knowledge Summary

Patent (1,485)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.98372620799002E-7
group 3 medulloblastoma 2254 1.61366436953473E-5
ovarian cancer 8492 0.00217861715691602
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00500176677196984
medulloblastoma, large-cell 6234 0.00513432011467516
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00717092327036355
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00914867943158482
Disease Target Count Z-score Confidence
Ohtahara syndrome 4 4.706 2.4

Expression

Synonym

Accession Q9HCP0 Q5JPH1 Q96AE9 Q9HCP1 CKI-gamma 1
Symbols CK1gamma1

Gene

PDB

2CMW  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (4)

PMID Text
24442433 CK1gamma1 phosphorylates p65 and consequently promotes its degradation by ubiquitin E3 ligases CUL2 and COMMD1.
21680713 casein kinase 1 gamma 1 phosphorylates claspin
18773076 Casein kinase 1 gamma 1 reduces HIV-1 infectivity by affecting Gag processing
12119564 A 1756 bp cDNA encoded human protein kinase CK1 (438 AA, mol wt 50.272 Da, isoelectric point of 9.37) mapping to chromosome 15q22.

AA Sequence

MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYV      1 - 70
AIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKT     71 - 140
VLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKS    141 - 210
LTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCE    211 - 280
NFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAIT    281 - 350
RESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR    351 - 420
HK                                                                        421 - 422
//

Text Mined References (18)

PMID Year Title
26428916 2016 Gene expression profiling of DMU-212-induced apoptosis and anti-angiogenesis in vascular endothelial cells.
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25416956 2014 A proteome-scale map of the human interactome network.
24463883 2014 Clinical whole-genome sequencing in severe early-onset epilepsy reveals new genes and improves molecular diagnosis.
24442433 2014 Casein kinase 1?1 inhibits the RIG-I/TLR signaling pathway through phosphorylating p65 and promoting its degradation.
21680713 2011 Role for casein kinase 1 in the phosphorylation of Claspin on critical residues necessary for the activation of Chk1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
More...