Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.22
PubTator Score 4.86

Knowledge Summary

Patent (1,485)

Expression

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYV      1 - 70
AIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLKT     71 - 140
VLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKEHVIHIIDFGLAKEYIDPETKKHIPYREHKS    141 - 210
LTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCE    211 - 280
NFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAIT    281 - 350
RESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR    351 - 420
HK                                                                        421 - 422
//

Text Mined References (18)

PMID Year Title