Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.07
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ulcerative colitis 2087 2.21364010508641E-6
malignant mesothelioma 3163 3.36897522732837E-6
interstitial cystitis 2299 3.60797683679066E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 6.6224299877571E-4
psoriasis 6685 0.00304131185499236
invasive ductal carcinoma 2950 0.00859327854735289
Waldenstrons macroglobulinemia 765 0.0185512108693305
non primary Sjogren syndrome sicca 840 0.018708244199243
active Crohn's disease 918 0.0216330663211213
Disease Target Count Z-score Confidence
Ovarian serous carcinoma 7 3.458 1.7

Expression

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (2)

PMID Text
23444373 SDF2L1 increases the time that misfolded proteins have to achieve a correctly folded conformation and thus that SDF2L1 can act as a buffer for substrate availability for ERAD in pancreatic beta-cells.
22190034 HIV-1 gp120 is identified to have a physical interaction with stromal cell-derived factor 2-like 1 (SDF2L1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MWSAGRGGAAWPVLLGLLLALLVPGGGAAKTGAELVTCGSVLKLLNTHHRVRLHSHDIKYGSGSGQQSVT      1 - 70
GVEASDDANSYWRIRGGSEGGCPRGSPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGD     71 - 140
DLDLWTVRCSGQHWEREAAVRFQHVGTSVFLSVTGEQYGSPIRGQHEVHGMPSANTHNTWKAMEGIFIKP    141 - 210
SVEPSAGHDEL                                                               211 - 221
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23444373 2013 SDF2L1 interacts with the ER-associated degradation machinery and retards the degradation of mutant proinsulin in pancreatic ?-cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11162531 2001 Murine and human SDF2L1 is an endoplasmic reticulum stress-inducible gene and encodes a new member of the Pmt/rt protein family.
10591208 1999 The DNA sequence of human chromosome 22.