Property Summary

NCBI Gene PubMed Count 165
Grant Count 97
R01 Count 56
Funding $9,866,874.22
PubMed Score 549.10
PubTator Score 422.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic cancer 1.200 0.004
pancreatic carcinoma 1.200 0.004

Synonym

Accession Q9HCN6 Q9HCN7 Q9UIF2 GPVI
Symbols GPIV
GPVI
BDPLT11

Gene

GP6

PDB

2GI7  

Gene RIF (152)

PMID Text
26308704 results support the idea that genetic variability of GP6 regulatory regions can be associated with platelet hyperaggregability - a possible cause of miscarriage
26282541 These results demonstrate that GP6 is a receptor for fibrin and provide evidence that this interaction contributes to thrombus growth and stability.
25977585 This study identifies GPVI as a platelet receptor for polymerized fibrin with 2 major functions: (1) amplification of thrombin generation and (2) recruitment of circulating platelets to clots.
25415317 data suggest a novel role for FAK in GPVI-dependent ROS formation and platelet activation and elucidate a proximal signaling role for FAK within the GPVI pathway.
25253166 measuring the level of sGPVI may be useful for assessing the activation of platelets in postoperative patients treated with anti-Xa agents and also for predicting the incidence of VTE in this population.
25086789 Results suggest that variants of GP6 SNPs, namely, rs1671153, rs1654410, rs1654419, and rs1613662, may be associated with risk of recurrent miscarriage.
24386454 Glaucocalyxin A inhibits platelet activation and thrombus formation preferentially via GPVI signaling pathway.
24325877 The plasma levels of sGPVI were the highest in patients with TMA without markedly reduced ADAMTS13 and those were significantly reduced after plasma exchange.
24245520 As sCD147 strongly correlates with platelet-specific sGPVI, a common platelet source and/or mechanism of release may contribute to sCD147 levels in vivo.
24126767 Lower platelet GPIV levels are associated with no-reflow phenomenon in patients with acute myocardial infarction.
More...

AA Sequence

MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQ      1 - 70
AVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGF     71 - 140
DQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPS    141 - 210
RLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVIL    211 - 280
IILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS               281 - 339
//

Text Mined References (166)

PMID Year Title
26308704 2015 Genetic variations of the GP6 regulatory region in patients with sticky platelet syndrome and miscarriage.
26282541 2015 Fibrin activates GPVI in human and mouse platelets.
25977585 2015 Platelet glycoprotein VI binds to polymerized fibrin and promotes thrombin generation.
25415317 2014 Role of focal adhesion tyrosine kinases in GPVI-dependent platelet activation and reactive oxygen species formation.
25253166 2014 Elevated soluble platelet glycoprotein VI is a useful marker for DVT in postoperative patients treated with edoxaban.
25086789 2014 Platelet-specific collagen receptor glycoprotein VI gene variants affect recurrent pregnancy loss.
24386454 2013 Glaucocalyxin A inhibits platelet activation and thrombus formation preferentially via GPVI signaling pathway.
24325877 2014 Elevated plasma levels of soluble platelet glycoprotein VI (GPVI) in patients with thrombotic microangiopathy.
24245520 2014 Circulating levels of soluble EMMPRIN (CD147) correlate with levels of soluble glycoprotein VI in human plasma.
24126767 2014 The relationship between platelet collagen receptor glycoprotein VI and no-reflow phenomenon in patients with acute ST-segment elevation myocardial infarction.
More...