Property Summary

NCBI Gene PubMed Count 171
PubMed Score 584.46
PubTator Score 422.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic cancer 1.200 4.3e-03
pancreatic carcinoma 1.200 4.3e-03

Protein-protein Interaction (1)

Gene RIF (157)

AA Sequence

MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQ      1 - 70
AVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGF     71 - 140
DQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPS    141 - 210
RLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVIL    211 - 280
IILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS               281 - 339
//

Text Mined References (172)

PMID Year Title