Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.78
PubTator Score 11.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 0.000
diabetes mellitus -1.200 0.003
ovarian cancer 1.700 0.000

Synonym

Accession Q9HCN4 B4DQJ5 B4DQM4 B4DXU4 B5MBZ5 O76004
Symbols XAB1
MBDIN
NTPBP
RPAP4
ATPBD1A

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
25241168 Gpn1-Gpn3 interaction was essential to maintain steady-state protein levels of both GTPases
22796641 A highly active, evolutionarily conserved nuclear export sequences in XAB1/Gpn1, was identified.
22174317 HIV-1 Rev interacting protein, GPN-loop GTPase 1 (GPN1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21768307 Data show that GPN1/GPN3 define a new family of small GTPases that are specialized for the transport of RNA polymerase II into the nucleus.
20855544 RPAP4/GPN1 is a member of a newly discovered GTPase family that contains a highly conserved GPN loop motif that is essential, along with its GTP-binding motifs, for nuclear localization of POLR2A/RPB1 in a process that also requires microtubule assembly
12588985 relieves MBD2-mediated transcriptional repression and reactivates transcription from methylated promoters

AA Sequence

MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDI      1 - 70
RDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIIT     71 - 140
EALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQ    141 - 210
DALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSL    211 - 280
ANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEE    281 - 350
SHEEPAFQNFMQESMAQYWKRNNK                                                  351 - 374
//

Publication (30)

PMID Year Title
25241168 2014 Gpn1 and Gpn3 associate tightly and their protein levels are mutually dependent in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796641 2012 A nuclear export sequence in GPN-loop GTPase 1, an essential protein for nuclear targeting of RNA polymerase II, is necessary and sufficient for nuclear export.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21844196 2011 GTP-dependent binding and nuclear transport of RNA polymerase II by Npa3 protein.
21768307 2011 Human GTPases associate with RNA polymerase II to mediate its nuclear import.
More...