Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.30
PubTator Score 11.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mouth Neoplasms 55 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 9.9e-05
lung cancer 4740 2.4e-04
diabetes mellitus 1728 2.5e-03
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 2.5e-03
lung cancer 1.400 2.4e-04
ovarian cancer 1.700 9.9e-05

Gene RIF (9)

AA Sequence

MAASAAAAELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDI      1 - 70
RDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVLIDTPGQIEVFTWSASGTIIT     71 - 140
EALASSFPTVVIYVMDTSRSTNPVTFMSNMLYACSILYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEAFQ    141 - 210
DALNQETTYVSNLTRSMSLVLDEFYSSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSL    211 - 280
ANAESQQQREQLERLRKDMGSVALDAGTAKDSLSPVLHPSDLILTRGTLDEEDEEADSDTDDIDHRVTEE    281 - 350
SHEEPAFQNFMQESMAQYWKRNNK                                                  351 - 374
//

Text Mined References (33)

PMID Year Title