Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 6
Funding $802,923.61
PubMed Score 16.59
PubTator Score 8.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.018
psoriasis -2.000 0.001
medulloblastoma, large-cell 1.100 0.001
group 3 medulloblastoma 1.100 0.006
non primary Sjogren syndrome sicca -1.200 0.020
Breast cancer -1.100 0.000

Gene RIF (13)

PMID Text
25108434 Data indicate that p53-regulated apoptosis-inducing protein 1 (p53AIP1) inhibits the proliferation of PC-3M cells, arrests cell cycle at S/G2-M phase, decreases the abilities of invasion and migration and promotes cell apoptosis.
24316591 These studies indicate the critical role of p53AIP1 under DNA damaging stresses for cell fate determination in rheumatoid arthritis-fibroblast-like synovioctes containing the p53R248Q mutation.
22457820 large sample size of the combined cohort rejects a high-risk effect greater than 2.2 and indicates a limited role of TP53AIP1 in prostate cancer predisposition
22334068 Apak competes with p53 for binding to inhibit p53AIP1 expression.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19228369 Data suggest that the combination of p53AIP1 and survivin gene expression may be a powerful tool to stratify subgroups with better or worse prognosis from the variable non-small cell lung cancer population.
18277909 Insufficient expression of p53AIP1 may play a role in gastric carcinogenesis in patients infected with H. pylori infection.
18277906 Insufficient expression of p53AIP1 may play a role in gastric carcinogenesis in patients infected with H. pylori infection.
17851056 p53AIP1 gene is important for non-small cell lung cancer progression and may be a possible prognostic marker
15657359 Roscovitine induced up-regulation of p53AIP1 protein and the depolarization of mitochondrial potential.
More...

AA Sequence

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSV      1 - 70
SSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ                     71 - 124
//

Text Mined References (21)

PMID Year Title
25108434 2014 [Effect of p53-regulated apoptosis-inducing protein 1 transfection on the biological characteristics of PC-3M human prostate cancer cells].
24316591 2014 Anti-apoptotic roles for the mutant p53R248Q through suppression of p53-regulated apoptosis-inducing protein 1 in the RA-derived fibroblast-like synoviocyte cell line MH7A.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22457820 2012 Prostate cancer risk is not altered by TP53AIP1 germline mutations in a German case-control series.
22334068 2012 Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19228369 2009 Combination of p53AIP1 and survivin expression is a powerful prognostic marker in non-small cell lung cancer.
18277909 2008 Insights in gastric carcinogenesis from Helicobacter pylori infection.
18277906 2008 Difference of p53AIP1 mRNA expression in gastric mucosa between patients with gastric cancer and chronic gastritis infected with Helicobacter pylori.
17851056 2008 p53AIP1 expression can be a prognostic marker in non-small cell lung cancer.
More...