Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.83
PubTator Score 8.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.100 7.1e-32
esophageal adenocarcinoma -1.100 1.8e-02
group 3 medulloblastoma 1.100 5.5e-03
medulloblastoma, large-cell 1.100 8.9e-04
non primary Sjogren syndrome sicca -1.200 2.0e-02
psoriasis -2.000 6.1e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (13)

AA Sequence

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSV      1 - 70
SSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ                     71 - 124
//

Text Mined References (21)

PMID Year Title