Property Summary

NCBI Gene PubMed Count 20
PubMed Score 18.31
PubTator Score 7.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis -1.100 0.000

Synonym

Accession Q9HCM9 Q5STG3 Q5STG4 Q76BL3 Q8IYT9 Q96IB6
Symbols TFP
RNF23
TRIM39B

Gene

PDB

2DID   2DIF   2ECJ  

Gene RIF (7)

PMID Text
26363554 TRIM39 negatively regulates the NFkappaB signaling pathway possibly via stabilization of cactin.
23707810 TRIM39R, but not TRIM39B, regulates type I interferon response
23213260 analysis of ubiquitylation of p53 by the APC/C inhibitor Trim39
23213251 TRIM39 has a role in regulating cell cycle progression and the balance between cytostasis and apoptosis after DNA damage via stabilizing p21
20875797 these findings suggest that RNF39 and TRIM39 are involved in the etiology of Behcet's disease.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19100260 Data suggest that TRIM39 can promote apoptosis signalling through stabilization of MOAP-1.

AA Sequence

MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCR      1 - 70
KTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTV     71 - 140
VPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDEEQQV    141 - 210
LLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLST    211 - 280
ICPRDHKALLGLVKEINRCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNL    281 - 350
VLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL    351 - 420
TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEK    421 - 490
LWPLFYPGIRAGRKNAAPLTIRPPTDWE                                              491 - 518
//

Publication (24)

PMID Year Title
26363554 2016 TRIM39 negatively regulates the NF?B-mediated signaling pathway through stabilization of Cactin.
25416956 2014 A proteome-scale map of the human interactome network.
23707810 2013 TRIM39R, but not TRIM39B, regulates type I interferon response.
23213260 2012 Ubiquitylation of p53 by the APC/C inhibitor Trim39.
23213251 2012 TRIM39 regulates cell cycle progression and DNA damage responses via stabilizing p21.
22529100 2012 The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.
22493164 2012 Systematic analysis of dimeric E3-RING interactions reveals increased combinatorial complexity in human ubiquitination networks.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20875797 2010 TRIM39 and RNF39 are associated with Behçet's disease independently of HLA-B?51 and -A?26.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
More...