Property Summary

NCBI Gene PubMed Count 20
PubMed Score 16.16
PubTator Score 7.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
tuberculosis 2010 4.8e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple personality disorder 8 4.485 2.2
Behcet's disease 89 3.399 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
tuberculosis -1.100 4.8e-07

Gene RIF (7)

AA Sequence

MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDLERDFPCPVCR      1 - 70
KTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTV     71 - 140
VPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPGELKRLVESRRQQILREFEELHRRLDEEQQV    141 - 210
LLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLST    211 - 280
ICPRDHKALLGLVKEINRCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNL    281 - 350
VLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL    351 - 420
TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEK    421 - 490
LWPLFYPGIRAGRKNAAPLTIRPPTDWE                                              491 - 518
//

Text Mined References (24)

PMID Year Title