Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 6.7e-12
glioblastoma 5792 6.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
glioblastoma -1.300 6.3e-05
lung carcinoma 1.300 6.7e-12

AA Sequence

MAHGSVTFRDVAIDFSQEEWEFLDPAQRDLYRDVMWENYSNFISLGPSISKPDVITLLDEERKEPGMVVR      1 - 70
EGTRRYCPDLESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFRNDWECKSKIEGEKEQQEGYF     71 - 140
GQVKITSEKMTTYKRHNFLTEYQIVHNGEKVYECKECRKTFIRRSTLSQHLRIHTGEKPYKCKECGQAFR    141 - 210
QRAHLIRHHKLHTGEKPYECKECGKAFTVLQELTQHQRLHTGEKPYECKECGKAFRVHQQLARHQRIHTG    211 - 280
EKPYECKDCGKTFRQCTHLTRHQRLHTAEKLYECKECGKAFVCGPDLRVHQKIHFGEKPYECKECGKAFR    281 - 350
ICQQLTVHQSIHTGEKPYECKECGKTFRLRQQLVRHQRIHTREKPYECMECWKTFSSYSQLISHQSIHIG    351 - 420
ERPYECEECGKAFRLLSQLTQHQSIHTGEKPYECKECRKPFRLLSQLTQHQSIHTGEKPYECKECGKAFR    421 - 490
LYSFLTQHQRIHTGEKPYKCKECKKAFRQHSHLTQHQKIHNGI                               491 - 533
//

Text Mined References (3)

PMID Year Title