Property Summary

NCBI Gene PubMed Count 25
PubMed Score 83.37
PubTator Score 44.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.451 3.4e-03
adult high grade glioma -1.100 4.2e-03
aldosterone-producing adenoma -1.195 3.2e-02
Atopic dermatitis -1.800 2.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.267 7.4e-03
Becker muscular dystrophy -1.275 2.2e-02
breast carcinoma -2.100 2.8e-14
ductal carcinoma in situ -4.300 6.8e-05
interstitial cystitis -1.100 1.7e-02
invasive ductal carcinoma -5.700 3.9e-05
limb girdle muscular dystrophy 2I -1.142 1.5e-02
non primary Sjogren syndrome sicca 1.200 2.1e-02
ovarian cancer -1.300 3.4e-08
pancreatic ductal adenocarcinoma liver m... -3.405 3.9e-04
Pick disease 1.200 1.1e-03
psoriasis -1.900 7.4e-04

Gene RIF (8)

AA Sequence

MDESALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKRPFVGRCCYSC      1 - 70
TPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQ     71 - 140
EAIAEVAAELNPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSFFWNIQIHKGQ    141 - 210
LEMVKAATETNLPLLFLPVHRSHIDYLLLTFILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRL    211 - 280
DETPDGRKDVLYRALLHGHIVELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILII    281 - 350
PVGISYDRIIEGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSA    351 - 420
LLSLEQALLPAILPSRPSDAADEGRDTSINESRNATDESLRRRLIANLAEHILFTASKSCAIMSTHIVAC    421 - 490
LLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLLGNCVTITHTSRNDEFFITPS    491 - 560
TTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLGGPTSTPPNLISQEQLVRKAASLCYLLSNEG    561 - 630
TISLPCQTFYQVCHETVGKFIQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEE    631 - 700
QRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVY    701 - 770
AESATYCLVKNAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL                771 - 828
//

Text Mined References (29)

PMID Year Title