Property Summary

NCBI Gene PubMed Count 43
PubMed Score 74.12
PubTator Score 33.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.8e-02
Astrocytoma, Pilocytic -2.500 6.3e-07
atypical teratoid / rhabdoid tumor -2.200 7.6e-05
ependymoma -1.300 6.3e-03
facioscapulohumeral dystrophy 1.900 4.9e-02
glioblastoma -1.500 4.9e-04
group 3 medulloblastoma -2.200 2.6e-04
head and neck cancer -1.200 3.2e-02
interstitial lung disease 1.900 2.3e-02
lung adenocarcinoma -1.900 2.1e-15
lung carcinoma -2.300 3.1e-19
medulloblastoma, large-cell -1.600 1.1e-02
non-small cell lung cancer -1.554 5.4e-14
oligodendroglioma -1.300 3.8e-03
osteosarcoma 1.686 2.9e-02
pituitary cancer -1.500 1.4e-05

Gene RIF (27)

AA Sequence

MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGER      1 - 70
VETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT     71 - 140
DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGMYTCVGTNMVG    141 - 210
ERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRI    211 - 280
KKTMSTDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKE    281 - 350
GSQNLLFPNQPQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII    351 - 420
LQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVA    421 - 490
TSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAF    491 - 560
SQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISPPAQGVDHRQV    561 - 630
QKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLV    631 - 700
NLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNG    701 - 770
IIQEYKIWCLGNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVV    771 - 840
ITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMSNGSR    841 - 910
PGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFT    911 - 980
TKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGG    981 - 1050
KKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLED   1051 - 1120
ELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSN   1121 - 1190
NQPPQPPVPPLGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSS   1191 - 1260
QRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHS   1261 - 1330
SSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL                         1331 - 1378
//

Text Mined References (45)

PMID Year Title