Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.11
PubTator Score 3.46

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.200 5.9e-03
adrenocortical carcinoma -1.147 3.8e-03
atypical teratoid / rhabdoid tumor -1.700 1.6e-02
glioblastoma -1.200 1.9e-02
lung carcinoma 1.700 5.7e-20
medulloblastoma -1.400 4.5e-02
medulloblastoma, large-cell -2.200 4.7e-04
pediatric high grade glioma -1.700 2.0e-03
primitive neuroectodermal tumor -1.300 1.9e-02
tuberculosis -2.100 1.5e-06

Gene RIF (2)

AA Sequence

MQKRQGYCSYCRVQYNNLEQHLFSAQHRSLTRQSRRQICTSSLMERFLQDVLQHHPYHCQESSSTQDETH      1 - 70
VNTGSSSEVVHLDDAFSEEEEEDEDKVEDEDATEERPSEVSEPIEELHSRPHKSQEGTQEVSVRPSVIQK     71 - 140
LEKGQQQPLEFVHKIGASVRKCNLVDIGQATNNRSNLVRPPVICNAPASCLPESSNDRPVTANTTSLPPA    141 - 210
AHLDSVSKCDPNKVEKYLEQPDGASRNPVPSSHVETTSFSYQKHKESNRKSLRMNSDKLVLWKDVKSQGK    211 - 280
TLSAGLKFHERMGTKGSLRVKSPSKLAVNPNKTDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNK    281 - 350
TAFWEQKCSVSSEMKFDCISLQSASDQPQETAQDLSLWKEEQIDQEDNYESRGSEMSFDCSSSFHSLTDQ    351 - 420
SKVSAKEVNLSKEVRTDVQYKNNKSYVSKISSDCDDILHLVTNQSQMIVKEISLQNARHISLVDQSYESS    421 - 490
SSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKNYGSSSSEVSADSVFPLQSVVDRPPVAVTET    491 - 560
KLRKKAHTSLVDNYGSSCSETSFDCDVSLESVVDHPQLTVKGRNLKGRQVHLKHKKRKPSSAKAHLDCDV    561 - 630
SLGTVADESQRAVEKINLLKEKNADLMDMNCESHGPEMGFQADAQLADQSQVAEIERQKVDVDLENKSVQ    631 - 700
SSRSSLSSDSPASLYHSAHDEPQEALDEVNLKELNIDMEVRSYDCSSSELTFDSDPPLLSVTEQSHLDAE    701 - 770
GKERHIDLEDESCESDSSEITFDSDIPLYSVIDQPEVAVYEEETVDLESKSNESCVSEITFDSDIPLHSG    771 - 840
NDHPEVAVKEVIQKEEYIHLERKNDEPSGSEISSDSHAPLHSVTNSPEVAVKKLNPQKEEQVHLENKENE    841 - 910
PIDSEVSLDYNIIFHSVTGRSEDPIKEISLHTKEHMYLENKSVFETSLDSDVPLQAATHKPEVIVKETWL    911 - 980
QREKHAEFQGRSTEFSGSKTSLDSGVPHYSVTEPQVAVNKINRKKQYVLENKNDKCSGSEIILDSNVPPQ    981 - 1050
SMTDQPQLAFLKEKHVNLKDKNSKSGDSKITFDSEQLQEAVKKIDQWKEEVIGLKNKINEPSTYKLIHHP   1051 - 1120
DVSVQSVADQPKVAIKHVNLGNENHMYLEVKNSQYSCSEMNLDSGFLGQSIVNRPQITILEQEHIELEGK   1121 - 1190
HNQCCGSEVSFDSDDPLQSVADRLRETVKEISLWKDEEVDTEDRRNEAKGFEIMYDSDVLQPVAGQPEEV   1191 - 1260
VKEVSLWKEHVDLENKIVKPTDSRINFDSHEPLQSVTNKIPGANKEINLLREEHVCLDDKGYVPSDSEII   1261 - 1330
YVSNIPLQSVIKQPHILEEEHASLEDKSSNSYSPEESSDSNDSFQAAADELQKPVKEINLWKEDHIYLED   1331 - 1400
KSYKLGDFDVSYASHIPVQFVTDQSSVPVKEINLQKKDHNDLENKNCEVCGSEIKCHSCVHLQSEVDQPQ   1401 - 1470
VSYKEADLQKEEHVVMEEKTDQPSDSEMMYDSDVPFQIVVNQFPGSVKETHLPKVVLVDLVPGDSDYEVI   1471 - 1540
SDDIPLQLVTDPPQLTVKDISCINTECIDIEDKSCDFFGSEVRCNCKASTPSMTNQCKETFKIINRKKDY   1541 - 1610
IILGEPSCQSCGSEMNFNVDASDQSMTYESQGPDEKMVKYIDSEDKSCGYNGSKGKFNLEDTSHRTTHRL   1611 - 1680
QKAHKEASLRKDPRNAGLKGKSCQSSASAVDFGASSKSALHRRADKKKRSKLKHRDLEVSCEPDGFEMNF   1681 - 1750
QCAPPLPSDTDQPQETVKKRHPCKKVSSDLKEKNHDSQSSSVLKVDSVRNLKKAKDVIEDNPDEPVLEAL   1751 - 1820
PHVPPSFVGKTWSQIMREDDIKINALVKEFREGRFHCYFDDDCETKKVSSKGKKKVTWADLQGKEDTAPT   1821 - 1890
QAVSESDDIVCGISDIDDLSVALDKPCHRHPPAERPPKQKGRVASQCQTAKISHSTQTSCKNYPVMKRKI   1891 - 1960
IRQEEDPPKSKCSRLQDDRKTKKKVKIGTVEFPASCTKVLKPMQPKALVCVLSSLNIKLKEGEGLPFPKM   1961 - 2030
RHHSWDNDIRFICKYKRNIFDYYEPLIKQIVISPPLSVIVPEFERRNWVKIHFNRSNQNSSAGDNDADGQ   2031 - 2100
GSASAPLMAVPARYGFNSHQGTSDSSLFLEESKVLHARELPKKRNFQLTFLNHDVVKISPKSVRNKLLES   2101 - 2170
QSKKKIHGKRVTTSSNKLGFPKKVYKPIILQQKPRKASEKQSIWIRTKPSDIIRKYISKYSVFLRHRYQS   2171 - 2240
RSAFLGRYLKKKKSVVSRLKKAKRTAKVLLNSSVPPAGAEELSSAMANPPPKRPVRASCRVARRRKKTDE   2241 - 2310
SYHGRQKGPSTPVRAYDLRSSSCLQQRERMMTRLANKLRGNEVK                             2311 - 2354
//

Text Mined References (8)

PMID Year Title