Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.59
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.0e-05
ependymoma 1.100 1.4e-02
glioblastoma 1.100 7.6e-05
group 3 medulloblastoma 1.600 6.0e-03
medulloblastoma, large-cell 1.600 2.6e-05
ovarian cancer -1.200 2.2e-03
primitive neuroectodermal tumor 1.200 1.7e-03

AA Sequence

MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIVFAAGSPFLRDQFLLNDSREV      1 - 70
KISILQSSEVGRQLLLSCYSGVLEFPEMELVNYLTAASFLQMSHIVERCTQALWKFIKPKQPMDSKEGCE     71 - 140
PQSASPQSKEQQGDARGSPKQDSPCIHPSEDSMDMEDSDIQIVKVESIGDVSEVRSKKDQNQFISSEPTA    141 - 210
LHSSEPQHSLINSTVENRVSEIEQNHLHNYALSYTGSDNIIMASKDVFGPNIRGVDKGLQWHHQCPKCTR    211 - 280
VFRHLENYANHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHSG    281 - 350
DKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTDSKGCQPQPDATQV    351 - 420
LDAGKLAQAVLNLRNDSTCVN                                                     421 - 441
//

Text Mined References (8)

PMID Year Title