Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.50
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
posterior fossa group A ependymoma 1511 6.18505404696129E-9
pilocytic astrocytoma 3086 0.00193592591952788
Pick disease 1893 0.0024051862499646
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00268317691809005
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00274544210740915
pituitary cancer 1972 0.00296851605018724
glioblastoma 5572 0.0155698827713882
adult high grade glioma 2148 0.032055987941192
adrenocortical carcinoma 1427 0.0483279553009591
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Cognitive disorder 44 0.0 1.0

Expression

Synonym

Accession Q9HCJ6 Q8IYW8
Symbols

Gene

PANTHER Protein Class (2)

PDB

4A27  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLFRKAMPEPQDGE      1 - 70
LKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVC     71 - 140
TPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVGQAVAQLCSTVPNVTVF    141 - 210
GTASTFKHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNM    211 - 280
VTGETKSFFSFAKSWWQVEKVNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPV    281 - 350
VDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQ     351 - 419
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.