Property Summary

NCBI Gene PubMed Count 11
Grant Count 4
R01 Count 4
Funding $299,150
PubMed Score 3.13
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (4)

PMID Text
25637521 Deregulation of LMNB1 expression induces modified splicing of several genes, likely driven by raver-2 overexpression, and suggest that an alteration of mRNA processing could be a pathogenic mechanism in adult-onset autosomal dominant leukodystrophy.
22561236 genetic polymorphism is ssociated with increased susceptibility for ulcerative colitis
22146317 Together, our results suggest that regulation of human Raver2 expression involves TATA-less transcriptional activity.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRK      1 - 70
ILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT     71 - 140
DALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGA    141 - 210
SALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYS    211 - 280
TAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNP    281 - 350
AMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQ    351 - 420
QLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPF    421 - 490
FPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSG    491 - 560
AASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEK    561 - 630
CIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY             631 - 691
//

Text Mined References (15)

PMID Year Title
25637521 2015 Messenger RNA processing is altered in autosomal dominant leukodystrophy.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22561236 2012 Association of the RAVER2 gene with increased susceptibility for ulcerative colitis.
22146317 2012 Transcriptional regulation of the human Raver2 ribonucleoprotein gene.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...