Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.20
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.6e-03
Breast cancer -1.200 4.0e-06
ependymoma 1.500 2.5e-02
interstitial cystitis -1.100 1.9e-03
intraductal papillary-mucinous carcinoma... 1.600 9.9e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.5e-02
lung adenocarcinoma -1.100 1.0e-10
osteosarcoma -1.970 5.5e-03
ulcerative colitis -2.100 1.3e-06

Gene RIF (4)

AA Sequence

MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRK      1 - 70
ILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPT     71 - 140
DALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGA    141 - 210
SALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYS    211 - 280
TAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNP    281 - 350
AMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQ    351 - 420
QLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPF    421 - 490
FPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSG    491 - 560
AASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEK    561 - 630
CIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY             631 - 691
//

Text Mined References (15)

PMID Year Title