Property Summary

NCBI Gene PubMed Count 16
PubMed Score 160.70
PubTator Score 204.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 2.000 0.013
posterior fossa group A ependymoma -3.300 0.000
glioblastoma -1.600 0.010
group 3 medulloblastoma -3.500 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.600 0.002
pediatric high grade glioma -1.300 0.010
pilocytic astrocytoma 1.600 0.001
psoriasis -1.200 0.000

Synonym

Accession Q9HCJ2 A8K0T1 Q7L0N3
Symbols NGL1
NGL-1

Gene

PDB

3ZYJ  

Gene RIF (5)

PMID Text
23986473 Interaction between the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029409 Observational study of gene-disease association. (HuGE Navigator)
14595443 netrin-G1 functions as an important component of the NGL-1 receptor to promote TCA outgrowth and that membrane-bound netrins can participate in receiving axonal signaling pathways.
14595443 NGL-1 is most abundant in the striatum and the cerebral cortex--the intermediate and final targets, of thalamocortical axons; surface-bound NGL-1 stimulates, but soluble NGL-1 disrupts, the growth of embryonic thalamic axons.

AA Sequence

MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV      1 - 70
PDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIP     71 - 140
NGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLR    141 - 210
EIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLT    211 - 280
LLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFT    281 - 350
CYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD    351 - 420
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVT    421 - 490
TSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHH    491 - 560
APTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMN    561 - 630
SKDNVQETQI                                                                631 - 640
//

Publication (17)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23986473 2013 Trans-induced cis interaction in the tripartite NGL-1, netrin-G1 and LAR adhesion complex promotes development of excitatory synapses.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
21946559 2011 Structural basis for cell surface patterning through NetrinG-NGL interactions.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029409 2010 Association of polymorphisms in the SLIT2 axonal guidance gene with anger in suicide attempters.
More...