Property Summary

NCBI Gene PubMed Count 17
PubMed Score 163.34
PubTator Score 204.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 7.3e-04
atypical teratoid / rhabdoid tumor -2.600 2.2e-04
ependymoma -3.000 4.4e-13
glioblastoma -1.300 3.5e-03
group 3 medulloblastoma -3.500 4.2e-05
medulloblastoma, large-cell -2.600 1.8e-03
oligodendroglioma 2.000 1.3e-02
pediatric high grade glioma -1.300 1.0e-02
psoriasis -1.200 5.6e-26

Gene RIF (6)

AA Sequence

MLNKMTLHPQQIMIGPRFNRALFDPLLVVLLALQLLVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREV      1 - 70
PDGISTNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIP     71 - 140
NGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLR    141 - 210
EIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLT    211 - 280
LLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWIKDMAPSNTACCARCNTPPNLKGRYIGELDQNYFT    281 - 350
CYAPVIVEPPADLNVTEGMAAELKCRASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQD    351 - 420
TGMYTCMVSNSVGNTTASATLNVTAATTTPFSYFSTVTVETMEPSQDEARTTDNNVGPTPVVDWETTNVT    421 - 490
TSLTPQSTRSTEKTFTIPVTDINSGIPGIDEVMKTTKIIIGCFVAITLMAAVMLVIFYKMRKQHHRQNHH    491 - 560
APTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMN    561 - 630
SKDNVQETQI                                                                631 - 640
//

Text Mined References (18)

PMID Year Title