Property Summary

NCBI Gene PubMed Count 16
PubMed Score 59.24
PubTator Score 8.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.200 7.2e-03
malignant mesothelioma 1.600 1.1e-07
osteosarcoma -1.199 6.6e-04
psoriasis -2.500 4.1e-04

 GO Component (2)

Gene RIF (4)

AA Sequence

MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTC      1 - 70
KGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFC     71 - 140
EETEKPSDSSFTLCLTHSPLPSTSEPTTDPQASLSPMSESTLSIAIGSSVINGLPTYNGLSIDRFGINIP    141 - 210
SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETV    211 - 280
SNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSE    281 - 350
KVQPLPISTIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISKTVLLSTKSMKKSHEHGSKKSH    351 - 420
SKTKPGILKKDKAVKEKIPSHHFMPGSPTKTVYKKPQEKKGCKCGRATQNPSVLTCRGQRCPCYSNRKAC    421 - 490
LDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAAS    491 - 560
THDDKSLDEAIDMRFDC                                                         561 - 577
//

Text Mined References (23)

PMID Year Title