Property Summary

NCBI Gene PubMed Count 15
Grant Count 10
R01 Count 7
Funding $670,622
PubMed Score 57.65
PubTator Score 8.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -2.500 0.000
osteosarcoma -1.199 0.001
group 3 medulloblastoma 1.200 0.007

Gene RIF (3)

PMID Text
23874665 Msl2 is a novel component of the vertebrate DNA damage response.
21726816 MSL2, together with MSL1, has robust histone ubiquitylation activity that mainly targets nucleosomal H2B on lysine 34.
16227571 A multisubunit human histone acetylase complex that contains homologs of the Drosophila MSL proteins MOF, MSL1 (hampin A), MSL2, and MSL3 was described. This complex is responsible for histone H4 lysine-16 acetylation of all cellular chromosomes.

AA Sequence

MNPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLLQDPIAPTNSTCQHYVCKTC      1 - 70
KGKKMMMKPSCSWCKDYEQFEENKQLSILVNCYKKLCEYITQTTLARDIIEAVDCSSDILALLNDGSLFC     71 - 140
EETEKPSDSSFTLCLTHSPLPSTSEPTTDPQASLSPMSESTLSIAIGSSVINGLPTYNGLSIDRFGINIP    141 - 210
SPEHSNTIDVCNTVDIKTEDLSDSLPPVCDTVATDLCSTGIDICSFSEDIKPGDSLLLSVEEVLRSLETV    211 - 280
SNTEVCCPNLQPNLEATVSNGPFLQLSSQSLSHNVFMSTSPALHGLSCTAATPKIAKLNRKRSRSESDSE    281 - 350
KVQPLPISTIIRGPTLGASAPVTVKRESKISLQPIATVPNGGTTPKISKTVLLSTKSMKKSHEHGSKKSH    351 - 420
SKTKPGILKKDKAVKEKIPSHHFMPGSPTKTVYKKPQEKKGCKCGRATQNPSVLTCRGQRCPCYSNRKAC    421 - 490
LDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAAS    491 - 560
THDDKSLDEAIDMRFDC                                                         561 - 577
//

Publication (21)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23874665 2013 Msl2 is a novel component of the vertebrate DNA damage response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084835 2012 Msl1-mediated dimerization of the dosage compensation complex is essential for male X-chromosome regulation in Drosophila.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20018852 2010 Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.
More...