Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.13
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
cystic fibrosis 1696 1.3e-04
primitive neuroectodermal tumor 3035 3.3e-04
group 3 medulloblastoma 4104 5.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
sarcoidosis 370 3.208 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.600 1.3e-04
group 3 medulloblastoma 1.500 5.9e-04
primitive neuroectodermal tumor 1.300 3.3e-04

 GO Process (1)

 Compartment GO Term (2)

AA Sequence

MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPSRPVLEYIDLVCGDDENPSAYYSDILFPKMPK      1 - 70
RQGDFLHFLNVKKVKTDTENNEVSKNHCRLSKAKEPHFEYIEQPIIEEKPSLSSKKEIDNLVLPDCWNEK     71 - 140
QAFMFTEQYKWLEIKEGKLGCKDCSAVRHLGSKAEKHVHVSKEWIAYLVTPNGSNKTTRQASLRKKIREH    141 - 210
DVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQEKNGEVN    211 - 280
CLNTRYSATRIAEHIAKEMKMKIFKNIIEENAKICIIIDEASTVSKKTTLVIYLQCTIQSAPAPVMLFVA    281 - 350
LKELVSTIAECIVNTLLTTLNDCGFTNEYLKANLIAFCSDGANTILGRKSGVATKLLENFPEIIIWNCLN    351 - 420
HRLQLSLDDSISEIKQINHLKIFIDKIYSIYHQPNKNQTKLLGTVAKELETEIIKIGRVMGPRWAACSLQ    421 - 490
AATAVWHAYPILYMHFSHSYSGLAKRLANINFLQDLALMIDILEEFSVLSTALQSRSTNIKKAQKLIKRT    491 - 560
IRALENLKIGTGKYESQIEDLIKSDKFKDIPFNKNNKFNALPRSILLDNIIQHMNLRLLSDRNHEDIFNY    561 - 630
FDLLEPSTWPYEEITSPWIAGEKTLFHLCKILKYEVDLNDFREFVNNNIKSNNVSIPTTIYKAKKIVSTI    631 - 700
AINSAEAERGFNLMNIICTRVRNSLTIDHVSDLMTINLLGKELADWDATPFVKSWSNCNHRLATDTRVRQ    701 - 770
KSTKVFHENQLAIWNLK                                                         771 - 787
//

Text Mined References (9)

PMID Year Title