Property Summary

NCBI Gene PubMed Count 9
PubMed Score 72.34
PubTator Score 4.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.600 6.7e-08
astrocytic glioma -2.200 3.6e-03
Astrocytoma, Pilocytic -1.600 6.3e-06
atypical teratoid / rhabdoid tumor -1.600 9.6e-08
ependymoma -3.000 8.2e-03
glioblastoma -2.000 5.3e-09
group 3 medulloblastoma -2.600 2.9e-05
intraductal papillary-mucinous adenoma (... -1.800 2.0e-03
intraductal papillary-mucinous carcinoma... -2.200 9.4e-04
medulloblastoma, large-cell -2.200 1.1e-05
oligodendroglioma -1.700 1.8e-02
Pick disease -1.100 5.1e-03
primitive neuroectodermal tumor -1.300 1.0e-03
subependymal giant cell astrocytoma -2.526 2.7e-02

Gene RIF (4)

AA Sequence

MSLVSQNSRRRRRRVAKATAHNSSWGEMQAPNAPGLPADVPGSDVPQGPSDSQILQGLCASEGPSTSVLP      1 - 70
TSAEGPSTFVPPTISEASSASGQPTISEGPGTSVLPTPSEGLSTSGPPTISKGLCTSVTLAASEGRNTSR     71 - 140
PPTSSEEPSTSVPPTASEVPSTSLPPTPGEGTSTSVPPTAYEGPSTSVVPTPDEGPSTSVLPTPGEGPGT    141 - 210
SVPLAATEGLSTSVQATPDEGPSTSVPPTATEGLSTPVPPTRDEGPSTSVPATPGEGPSTSVLPAASDGQ    211 - 280
SISLVPTRGKGSSTSVPPTATEGLSTSVQPTAGEGSSTSVPPTPGGGLSTSVPPTATEELSTSVPPTPGE    281 - 350
GPSTSVLPIPGEGLSTSVPPTASDGSDTSVPPTPGEGASTLVQPTAPDGPGSSVLPNPGEGPSTLFSSSA    351 - 420
SVDRNPSKCSLVLPSPRVTKASVDSDSEGPKGAEGPIEFEVLRDCESPNSISIMGLNTSRVAITLKPQDP    421 - 490
MEQNVAELLQFLLVKDQSKYPIRESEMREYIVKEYRNQFPEILRRAAAHLECIFRFELRELDPEAHTYIL    491 - 560
LNKLGPVPFEGLEESPNGPKMGLLMMILGQIFLNGNQAKEAEIWEMLWRMGVQRERRLSIFGNPKRLLSV    561 - 630
EFVWQRYLDYRPVTDCKPVEYEFFWGPRSHLETTKMKILKFMAKIYNKDPMDWPEKYNEALEEDAARAFA    631 - 700
EGWQALPHFRRPFFEEAAAEVPSPDSEVSSYSSKYAPHSWPESRLESKARKLVQLFLLMDSTKLPIPKKG    701 - 770
ILYYIGRECSKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEETEEIVDSPNRPGNNFLMQ    771 - 840
VLSFIFIMGNHARESAVWAFLRGLGVQAGRKHVITCRYLSQRYIDSLRVPDSDPVQYEFVWGPRARLETS    841 - 910
KMKALRYVARIHRKEPQDWPQQYREAMEDEANRADVGHRQIFVHNFR                           911 - 957
//

Text Mined References (13)

PMID Year Title