Property Summary

NCBI Gene PubMed Count 31
Grant Count 4
R01 Count 4
Funding $572,250
PubMed Score 19.29
PubTator Score 22.66

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
25940347 SLP2 is a Rab27a effector required for HIV-1 Gag assembly at the plasma membrane in Jurkat cells
25940347 SLP2 is a Rab27a effector required for HIV-1 Gag assembly at the plasma membrane in Jurkat cells
25940347 Silencing of SLP2 by shRNA inhibits HIV-1 replication in Jurkat cells
21223688 SLP2 may play an important role in tumorigenesis of esophageal squamous cell carcinoma.
20729199 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons
20654157 A high expression level of SLP-2 may be associating with the development of invasion and metastasis in laryngeal squamous cell carcinoma and breast cancer.
18832576 Rab27A/Slp2a expression in limb girdle muscular dystrophy 2B muscle provides a compensatory vesicular trafficking pathway that is able to repair membrane damage in the absence of dysferlin.
18812475 Rab27a recruits Slp2a-hem on vesicular structures in peripheral CTLs and following CTL-target cell conjugate formation, the Slp2a-hem/Rab27a complex colocalizes with perforin-containing granules at the immunologic synapse
18266782 These results suggest that both Slp1 and Slp2-a may form part of a docking complex, capturing secretory lysosomes at the immunological synapse.
17672918 occurrence of an unusual TG 3' splice site in intron 9
More...

AA Sequence

MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD      1 - 70
IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV     71 - 140
IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS    141 - 210
IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS    211 - 280
STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG    281 - 350
REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL    351 - 420
HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE    421 - 490
EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMS    491 - 560
KSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKG    561 - 630
NIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEIL    631 - 700
RYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRG    701 - 770
EMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTN    771 - 840
PIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKM    841 - 910
VNSPNTWIEATLPLRMLLIAKISK                                                  911 - 934
//

Publication (33)

PMID Year Title
24284068 2014 Slp2-a controls renal epithelial cell size through regulation of Rap-ezrin signaling independently of Rab27.
22820376 2012 Synaptotagmin-like proteins control the formation of a single apical membrane domain in epithelial cells.
22724020 2012 Deregulation of Rab and Rab effector genes in bladder cancer.
21223688 2010 [Expression of SLP-2 protein in esophageal squamous cell carcinoma is associated with cancer invasion].
20729199 2010 Calmodulin suppresses synaptotagmin-2 transcription in cortical neurons.
20654157 2010 [Relationship between SLP-2 expression and prognosis in laryngeal squamous cell carcinoma and mammary invasive carcinoma].
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18940603 2008 Elucidation of Rab27 recruitment by its effectors: structure of Rab27a bound to Exophilin4/Slp2-a.
18832576 2008 Dysferlin deficiency shows compensatory induction of Rab27A/Slp2a that may contribute to inflammatory onset.
18812475 2008 A newly identified isoform of Slp2a associates with Rab27a in cytotoxic T cells and participates to cytotoxic granule secretion.
More...