Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.10
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.100 6.4e-07
atypical teratoid / rhabdoid tumor -1.900 5.0e-05
ependymoma -2.000 8.5e-09
glioblastoma multiforme -1.600 1.0e-14
group 3 medulloblastoma -1.800 4.4e-02
interstitial cystitis 2.700 7.8e-04
interstitial lung disease 1.100 9.8e-03
medulloblastoma, large-cell -2.500 1.3e-03
osteosarcoma 2.314 6.6e-05
periodontitis 1.700 7.0e-29
Pick disease -1.600 5.1e-03
primitive neuroectodermal tumor -1.300 4.7e-02
progressive supranuclear palsy 1.100 1.6e-02
ulcerative colitis 1.100 3.4e-03

Gene RIF (2)

AA Sequence

MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWREFGRTEVIDN      1 - 70
TLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFS     71 - 140
LNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDG    141 - 210
TFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQ    211 - 280
FNIYEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHY    281 - 350
MSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH    351 - 420
RSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGV    421 - 490
GQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKA    491 - 560
QGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI                                         561 - 593
//

Text Mined References (15)

PMID Year Title