Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.91
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
periodontitis 269 6.99588803260132E-29
glioblastoma multiforme 347 1.01298413043314E-14
medulloblastoma 1524 1.66316456442065E-7
posterior fossa group B ependymoma 1530 3.77378675179844E-7
astrocytoma 1493 6.40931714013593E-7
atypical teratoid / rhabdoid tumor 4369 5.03221381846349E-5
osteosarcoma 7933 6.58867284775769E-5
interstitial cystitis 2299 7.82008999803402E-4
medulloblastoma, large-cell 6234 0.00129450399143116
ulcerative colitis 2087 0.00340921283997826
Pick disease 1893 0.0050528684146936
interstitial lung disease 292 0.00977863413239627
progressive supranuclear palsy 674 0.0158521420851322
primitive neuroectodermal tumor 3031 0.0470714092797195

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial lung disease 1.100 0.010
astrocytoma -1.100 0.000
glioblastoma multiforme -1.600 0.000
osteosarcoma 2.314 0.000
posterior fossa group B ependymoma -2.200 0.000
medulloblastoma -2.600 0.000
periodontitis 1.700 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.500 0.001
primitive neuroectodermal tumor -1.300 0.047
interstitial cystitis 2.700 0.001
Pick disease -1.600 0.005
progressive supranuclear palsy 1.100 0.016
ulcerative colitis 1.100 0.003

Synonym

Accession Q9HCH3 Q7Z6C8
Symbols CPN5
COPN5

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Gene RIF (2)

PMID Text
26522866 Results provide the first evidence of genetic variants in the CPNE5 gene influencing both alcohol dependence and obesity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWREFGRTEVIDN      1 - 70
TLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFS     71 - 140
LNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDG    141 - 210
TFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQ    211 - 280
FNIYEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHY    281 - 350
MSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH    351 - 420
RSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGV    421 - 490
GQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKA    491 - 560
QGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI                                         561 - 593
//

Text Mined References (15)

PMID Year Title
26522866 2015 Genetic variants in the CPNE5 gene are associated with alcohol dependence and obesity in Caucasian populations.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...