Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.91
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
interstitial lung disease 1.100 0.010
astrocytoma -1.100 0.000
glioblastoma multiforme -1.600 0.000
osteosarcoma 2.314 0.000
posterior fossa group B ependymoma -2.200 0.000
medulloblastoma -2.600 0.000
periodontitis 1.700 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.500 0.001
primitive neuroectodermal tumor -1.300 0.047
interstitial cystitis 2.700 0.001
Pick disease -1.600 0.005
progressive supranuclear palsy 1.100 0.016
ulcerative colitis 1.100 0.003

Gene RIF (2)

PMID Text
26522866 Results provide the first evidence of genetic variants in the CPNE5 gene influencing both alcohol dependence and obesity
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWREFGRTEVIDN      1 - 70
TLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFS     71 - 140
LNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDG    141 - 210
TFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWDRDGSHDFIGEFTTSYRELARGQSQ    211 - 280
FNIYEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHY    281 - 350
MSPYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYH    351 - 420
RSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGV    421 - 490
GQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARLARDVLAEIPDQLVSYMKA    491 - 560
QGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI                                         561 - 593
//

Text Mined References (15)

PMID Year Title
26522866 2015 Genetic variants in the CPNE5 gene are associated with alcohol dependence and obesity in Caucasian populations.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23583979 2013 Identification of heart rate-associated loci and their effects on cardiac conduction and rhythm disorders.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
More...