Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.91
PubTator Score 0.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.167 0.000
medulloblastoma 1.100 0.004

Synonym

Accession Q9HCH0 Q2TB26 Q71RH1 Q8N4W1 Q96HX2 NCKAP5-like
Symbols Cep169
FP1193
KIAA1602

Gene

Gene RIF (2)

PMID Text
26549230 These data suggest that the dissociation of Cep169 from centrosomes is controlled by Cdk1/Cyclin B during mitosis, and that Cep169 might regulate MT dynamics of mitotic spindle.
26485573 These results show that Cep169 targets microtubule tips and regulates stability of microtubules with CDK5RAP2.

AA Sequence

MDQPAGGPGNPRPGEGDDGSMEPGTCQELLHRLRELEAENSALAQANENQRETYERCLDEVANHVVQALL      1 - 70
NQKDLREECIKLKKRVFDLERQNQMLSALFQQKLQLTTGSLPQIPLTPLQPPSEPPASPSLSSTEGPAAP     71 - 140
LPLGHCAGQREVCWEQQLRPGGPGPPAAPPPALDALSPFLRKKAQILEVLRALEETDPLLLCSPATPWRP    141 - 210
PGQGPGSPEPINGELCGPPQPEPSPWAPCLLLGPGNLGGLLHWERLLGGLGGEEDTGRPWGPSRGPPQAQ    211 - 280
GTSSGPNCAPGSSSSSSSDEAGDPNEAPSPDTLLGALARRQLNLGQLLEDTESYLQAFLAGAAGPLNGDH    281 - 350
PGPGQSSSPDQAPPQLSKSKGLPKSAWGGGTPEAHRPGFGATSEGQGPLPFLSMFMGAGDAPLGSRPGHP    351 - 420
HSSSQVKSKLQIGPPSPGEAQGPLLPSPARGLKFLKLPPTSEKSPSPGGPQLSPQLPRNSRIPCRNSGSD    421 - 490
GSPSPLLARRGLGGGELSPEGAQGLPTSPSPCYTTPDSTQLRPPQSALSTTLSPGPVVSPCYENILDLSR    491 - 560
STFRGPSPEPPPSPLQVPTYPQLTLEVPQAPEVLRSPGVPPSPCLPESYPYGSPQEKSLDKAGSESPHPG    561 - 630
RRTPGNSSKKPSQGSGRRPGDPGSTPLRDRLAALGKLKTGPEGALGSEKNGVPARPGTEKTRGPGKSGES    631 - 700
AGDMVPSIHRPLEQLEAKGGIRGAVALGTNSLKQQEPGLMGDPGARVYSSHSMGARVDLEPVSPRSCLTK    701 - 770
VELAKSRLAGALCPQVPRTPAKVPTSAPSLGKPNKSPHSSPTKLPSKSPTKVVPRPGAPLVTKESPKPDK    771 - 840
GKGPPWADCGSTTAQSTPLVPGPTDPSQGPEGLAPHSAIEEKVMKGIEENVLRLQGQERAPGAEVKHRNT    841 - 910
SSIASWFGLKKSKLPALNRRTEATKNKEGAGGGSPLRREVKMEARKLEAESLNISKLMAKAEDLRRALEE    911 - 980
EKAYLSSRARPRPGGPAPGPNTGLGQVQGQLAGMYQGADTFMQQLLNRVDGKELPSKSWREPKPEYGDFQ    981 - 1050
PVSSDPKSPWPACGPRNGLVGPLQGCGKPPGKPSSEPGRREETPSEDSLAEPVPTSHFTACGSLTRTLDS   1051 - 1120
GIGTFPPPDHGSSGTPSKNLPKTKPPRLDPPPGVPPARPPPLTKVPRRAHTLEREVPGIEELLVSGRHPS   1121 - 1190
MPAFPALLPAAPGHRGHETCPDDPCEDPGPTPPVQLAKNWTFPNTRAAGSSSDPLMCPPRQLEGLPRTPM   1191 - 1260
ALPVDRKRSQEPSRPSPTPQGPPFGGSRTPSTSDMAEEGRVASGGPPGLETSESLSDSLYDSLSSCGSQG   1261 - 1330
//

Publication (15)

PMID Year Title
26549230 2015 Phosphorylation of the centrosomal protein, Cep169, by Cdk1 promotes its dissociation from centrosomes in mitosis.
26485573 2015 Cep169, a Novel Microtubule Plus-End-Tracking Centrosomal Protein, Binds to CDK5RAP2 and Regulates Microtubule Stability.
26482847 2015 Microtubule-bundling activity of the centrosomal protein, Cep169, and its binding to microtubules.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16541075 2006 The finished DNA sequence of human chromosome 12.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...