Property Summary

Ligand Count 110
NCBI Gene PubMed Count 32
PubMed Score 43.14
PubTator Score 22.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.100 5.2e-06
atypical teratoid / rhabdoid tumor -1.100 8.5e-08
ependymoma -1.100 3.8e-11
glioblastoma -1.100 1.4e-04
intraductal papillary-mucinous carcinoma... 1.200 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
osteosarcoma -1.168 2.5e-06
ovarian cancer 1.100 8.1e-05

Gene RIF (46)

AA Sequence

MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETGGTKDVQVTDCKSPEDSRPPKETDCCNPEDSGQLMV      1 - 70
SYEGKAMGYQVPPFGWRICLAHEFTEKRKPFQANNVSLSNMIKHIGMGLRYLQWWYRKTHVEKKTPFIDM     71 - 140
INSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHRTVIADQFTVCLRREGQTVYQQVLSLER    141 - 210
PSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGD    211 - 280
EALDVSIMFSMRNGLGGGDDAPGGLWNEPFCLERSGETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHI    281 - 350
TAFDPDSTGQQVWQDLLQDGQLDSPTGQSTPTQKGVGIAGAVCVSSKLRPRGQCRLEFSLAWDMPRIMFG    351 - 420
AKGQVHYRRYTRFFGQDGDAAPALSHYALCRYAEWEERISAWQSPVLDDRSLPAWYKSALFNELYFLADG    421 - 490
GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVHFYASFALIMLWPKLELSLQY    491 - 560
DMALATLREDLTRRRYLMSGVMAPVKRRNVIPHDIGDPDDEPWLRVNAYLIHDTADWKDLNLKFVLQVYR    561 - 630
DYYLTGDQNFLKDMWPVCLAVMESEMKFDKDHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMV    631 - 700
QMAALCGAQDIQDKFSSILSRGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDT    701 - 770
EVFPTQHVVRALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWE    771 - 840
GFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASWPKVKQGTGLR    841 - 910
TGPMFGPKEAMANLSPE                                                         911 - 927
//

Text Mined References (32)

PMID Year Title