Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.21
PubTator Score 5.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 4.55128397797589E-13
psoriasis 6685 3.68232637515604E-10
osteosarcoma 7933 3.88300081615812E-5
Pick disease 1893 4.49130602769226E-4
oligodendroglioma 2849 9.36515109980361E-4
group 4 medulloblastoma 1875 0.00116334554131335
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0015163210654787
ependymoma 2514 0.00159419382661764
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00257006774837154
astrocytic glioma 2241 0.00409080075345943
Multiple myeloma 1328 0.00497849952871397
adrenocortical carcinoma 1427 0.0109144961936748
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0352135980818103
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (13)

Synonym

Accession Q9HCG1 Q14589 Q504Q8 Q96JC5 Q9BVY9 Q9H7N6
Symbols F11
HZF5
KR18
HKr18

Gene

  Ortholog (1)

Species Source
Macaque OMA Inparanoid

Gene RIF (1)

PMID Text
19846881 TLR4 gene transcription was repressed by epigenetic regulations, which were, at least in part, dependent on ZNF160.

AA Sequence

MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVK      1 - 70
SCVKIARKPRTPECVKGVVTDIPPKCTIKDLLPKEKSSTEAVFHTVVLERHESPDIEDFSFKEPQKNVHD     71 - 140
FECQWRDDTGNYKGVLMAQKEGKRDQRDRRDIENKLMNNQLGVSFHSHLPELQLFQGEGKMYECNQVEKS    141 - 210
TNNGSSVSPLQQIPSSVQTHRSKKYHELNHFSLLTQRRKANSCGKPYKCNECGKAFTQNSNLTSHRRIHS    211 - 280
GEKPYKCSECGKTFTVRSNLTIHQVIHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAF    281 - 350
RGHSNLTTHQLIHTGEKPFKCNECGKLFTQNSHLISHWRIHTGEKPYKCNECGKAFSVRSSLAIHQTIHT    351 - 420
GEKPYKCNECGKVFRYNSYLGRHRRVHTGEKPYKCNECGKAFSMHSNLATHQVIHTGTKPFKCNECSKVF    421 - 490
TQNSQLANHRRIHTGEKPYKCNECGKAFSVRSSLTTHQAIHSGEKPYKCIECGKSFTQKSHLRSHRGIHS    491 - 560
GEKPYKCNECGKVFAQTSQLARHWRVHTGEKPYKCNDCGRAFSDRSSLTFHQAIHTGEKPYKCHECGKVF    561 - 630
RHNSYLATHRRIHTGEKPYKCNECGKAFSMHSNLTTHKVIHTGEKPYKCNQCGKVFTQNSHLANHQRTHT    631 - 700
GEKPYRCNECGKAFSVRSSLTTHQAIHTGKKPYKCNECGKVFTQNAHLANHRRIHTGEKPYRCTECGKAF    701 - 770
RVRSSLTTHMAIHTGEKRYKCNECGKVFRQSSNLASHHRMHTGEKPYK                          771 - 818
//

Text Mined References (11)

PMID Year Title
19846881 2009 Epigenetic regulation of TLR4 gene expression in intestinal epithelial cells for the maintenance of intestinal homeostasis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11410164 2001 Molecular cloning and preliminary functional analysis of two novel human KRAB zinc finger proteins, HKr18 and HKr19.
11214971 2000 Characterization of long cDNA clones from human adult spleen.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
7865130 1995 Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937.
More...