Property Summary

NCBI Gene PubMed Count 37
Grant Count 19
R01 Count 18
Funding $2,904,495.6
PubMed Score 123.91
PubTator Score 55.11

Knowledge Summary

Patent (12,163)

Expression

  Differential Expression (13)

Disease log2 FC p
oligodendroglioma -1.800 0.018
glioblastoma -3.900 0.000
ependymoma -3.800 0.000
atypical teratoid/rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -2.700 0.031
primitive neuroectodermal tumor -3.300 0.001
lung cancer 1.700 0.000
pediatric high grade glioma -4.100 0.000
sonic hedgehog group medulloblastoma -3.900 0.000
pilocytic astrocytoma -4.000 0.000
subependymal giant cell astrocytoma -1.200 0.047
Pick disease 1.100 0.009
ovarian cancer -1.900 0.000

Gene RIF (23)

PMID Text
26546534 This is the first study to examine the involvement of TRPM channel gene variations on the risk of SSc incidence. Our results suggest roles of TRPM3 and TRPM5 gene variants in the susceptibility to or clinical expression of Systemic sclerosis
26493679 Activation of TRPM3 channels increases the transcriptional activation potential of c-Fos in HEK293 cells.
26123195 TRPM3 is a phosphoinositide-dependent ion channel.
26123194 The TRPM3 activity is rapidly and reversibly inhibited by activation of phosphatases.
25576487 TRPM3 channel activation changes the gene expression pattern of the cells by activating transcription of c-Jun-, ATF2-, and TCF-controlled genes.
25517751 The von Hippel-Lindau tumor suppressor (VHL) represses TRPM3 directly through miR-204 and indirectly through another miR-204 target, Caveolin 1.
25090642 Missense mutation in the cation channel, TRPM3, underlies inherited cataract and glaucoma.
24895737 Pregnenolone sulfate is a powerful activator of TRPM3-mediated gene transcription, while transcription is completely inhibited by mefenamic acid in cells expressing activated TRPM3 channels.
23121507 Data using recombinant proteins expressed in vascular endothelial cells suggest that SigmaR1 (sigma 1-type opioid receptor) is not involved in regulation of calcium signaling via TRPC5/TRPM3 (transient receptor potential cation channels C5/M3).
22961981 TRPM3-ICF deletion mutation variants are regulatory channel subunits fine-tuning TRPM3 channel activity.
More...

AA Sequence

MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKAQKSWIERAFY      1 - 70
KRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFG     71 - 140
TIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKA    141 - 210
AMTTGAWIFTGGVNTGVIRHVGDALKDHASKSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMS    211 - 280
KLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVG    281 - 350
IGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLV    351 - 420
TIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAPDQLSLALAWN    421 - 490
RVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTL    491 - 560
YHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIP    561 - 630
LRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKA    631 - 700
MAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHR    701 - 770
DFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEP    771 - 840
EKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWFYTLAYIGYLM    841 - 910
LFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQEYWNVTDLIAILLFSVG    911 - 980
MILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVA    981 - 1050
RQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMAC   1051 - 1120
YLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRW   1121 - 1190
RKHESDPDERDYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEV   1191 - 1260
NEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQE   1261 - 1330
GNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLESIFKERSLSLHRATSSHSVAK   1331 - 1400
EPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDIDPLDNSVNILGLGEPSFSTPVPSTAPSSSAY   1401 - 1470
ATLAPTDRPPSRSIDFEDITSMDTRSFSSDYTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEA   1471 - 1540
PIVKSHSFMFSPSRSYYANFGVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPE   1541 - 1610
REAELSHPSSDSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFS   1611 - 1680
ISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN                     1681 - 1732
//

Text Mined References (38)

PMID Year Title
27227024 TRPM3 in temperature sensing and beyond.
26546534 Association of TRPM Channel Gene Polymorphisms with Systemic Sclerosis.
26493679 2016 CREB, AP-1, ternary complex factors and MAP kinases connect transient receptor potential melastatin-3 (TRPM3) channel stimulation with increased c-Fos expression.
26123195 2015 Transient receptor potential melastatin 3 is a phosphoinositide-dependent ion channel.
26123194 2015 Regulation of the transient receptor potential channel TRPM3 by phosphoinositides.
25576487 2015 Transient receptor potential melastatin-3 (TRPM3)-induced activation of AP-1 requires Ca2+ ions and the transcription factors c-Jun, ATF2, and ternary complex factor.
25517751 2014 TRPM3 and miR-204 establish a regulatory circuit that controls oncogenic autophagy in clear cell renal cell carcinoma.
25090642 2014 Mutation of the melastatin-related cation channel, TRPM3, underlies inherited cataract and glaucoma.
24895737 2014 Activation and inhibition of transient receptor potential TRPM3-induced gene transcription.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
More...