Property Summary

NCBI Gene PubMed Count 76
Grant Count 60
R01 Count 31
Funding $5,023,322.15
PubMed Score 75.06
PubTator Score 69.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Gene

PANTHER Protein Class (2)

PDB

2LAZ   2LB0   2LB1   2LTX   3PYC  

Gene RIF (50)

PMID Text
26252093 NF-kappaB bind to the -411 to -420 region of the SMURF1 promoter and plays an essential role in the expression of SMURF1.
26015066 EGF/Smurf1 inhibits Wnt/beta-catenin-induced osteogenic differentiation and that Smurf1 downregulates Wnt/b-catenin signaling by enhancing proteasomal degradation of beta-catenin.
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1.
25721664 Fbxo3 promotes the proteasomal degradation of Smurf1. Fbxo3 promotes the poly-ubiquitination of Smurf1.
25596283 SND1 promoted expression of the E3 ubiquitin ligase Smurf1, leading to RhoA ubiquitination and degradation.
25471937 The role of SMURF1 and inhibition of BMP signaling in maintaining a CSC-like population was confirmed by the loss of a CD44(high) expressing.
25311538 TRIB2 associated-ubiquitin E3 ligases beta-transducin repeat-containing E3 ubiquitin protein ligase (beta-TrCP), COP1 and Smad ubiquitination regulatory factor 1 (Smurf1) reduced TCF4/beta-Catenin expression, and these effects could be enhanced by TRIB2.
25260729 results reveal the regulatory circuit between RUNX2 and SMURF1 controls RUNX2 expression and regulates odntoblastic differentiation in hDPSCs.
25249323 Smurf1 determines cell apoptosis rates downstream of DNA damage-induced ATR/Chk1 signalling by promoting degradation of RhoB.
25051198 Results suggest that elevated transcription and expression levels of ubiquitin ligase E3s WWP1, Smurf1 and Smurf2 genes may be the mechanisms of occurrence, development and metastasis of prostate cancer.
More...

AA Sequence

MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDPKWNQHYDLYV      1 - 70
GKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCKLNPSDTDAVRGQIVVSLQTR     71 - 140
DRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQ    141 - 210
RLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAA    211 - 280
FLYEFLLQGHTSEPRDLNSVNCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLK    281 - 350
EPSQPLPLPSEGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMR    351 - 420
PKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFH    421 - 490
FVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVLDHTFCVEHN    491 - 560
AFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDQKELEL    561 - 630
IIGGLDKIDLNDWKSNTRLKHCVADSNIVRWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTG    631 - 700
AAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE                 701 - 757
//

Text Mined References (79)

PMID Year Title
26252093 2015 [Regulation of Smad ubiquitination regulatory factor 1 expression by NF-?B].
26015066 2015 EGF Inhibits Wnt/?-Catenin-Induced Osteoblast Differentiation by Promoting ?-Catenin Degradation.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25721664 2015 F-box protein Fbxo3 targets Smurf1 ubiquitin ligase for ubiquitination and degradation.
25596283 2015 SND1 Acts Downstream of TGF?1 and Upstream of Smurf1 to Promote Breast Cancer Metastasis.
25471937 2014 SMURF1 silencing diminishes a CD44-high cancer stem cell-like population in head and neck squamous cell carcinoma.
25311538 2014 TRIB2 inhibits Wnt/?-Catenin/TCF4 signaling through its associated ubiquitin E3 ligases, ?-TrCP, COP1 and Smurf1, in liver cancer cells.
25260729 2014 A feedback loop between RUNX2 and the E3 ligase SMURF1 in regulation of differentiation of human dental pulp stem cells.
25249323 2014 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance.
25051198 2014 Bortezomib prevents oncogenesis and bone metastasis of prostate cancer by inhibiting WWP1, Smurf1 and Smurf2.
More...