Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.23
PubTator Score 0.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 1.300 2.0e-02
lung adenocarcinoma 1.182 3.0e-05
lung cancer 2.000 8.7e-05
osteosarcoma 2.811 5.5e-06
ovarian cancer -1.900 5.4e-07
pancreatic cancer 1.700 1.4e-03
pancreatic ductal adenocarcinoma liver m... 1.247 3.5e-02
psoriasis 1.200 4.5e-03

Gene RIF (1)

AA Sequence

MTMGDMKTPDFDDLLAAFDIPDMVDPKAAIESGHDDHESHMKQNAHGEDDSHAPSSSDVGVSVIVKNVRN      1 - 70
IDSSEGGEKDGHNPTGNGLHNGFLTASSLDSYSKDGAKSLKGDVPASEVTLKDSTFSQFSPISSAEEFDD     71 - 140
DEKIEVDDPPDKEDMRSSFRSNVLTGSAPQQDYDKLKALGGENSSKTGLSTSGNVEKNKAVKRETEASSI    141 - 210
NLSVYEPFKVRKAEDKLKESSDKVLENRVLDGKLSSEKNDTSLPSVAPSKTKSSSKLSSCIAAIAALSAK    211 - 280
KAASDSCKEPVANSRESSPLPKEVNDSPRAADKSPESQNLIDGTKKPSLKQPDSPRSISSENSSKGSPSS    281 - 350
PAGSTPAIPKVRIKTIKTSSGEIKRTVTRVLPEVDLDSGKKPSEQTASVMASVTSLLSSPASAAVLSSPP    351 - 420
RAPLQSAVVTNAVSPAELTPKQVTIKPVATAFLPVSAVKTAGSQVINLKLANNTTVKATVISAASVQSAS    421 - 490
SAIIKAANAIQQQTVVVPASSLANAKLVPKTVHLANLNLLPQGAQATSELRQVLTKPQQQIKQAIINAAA    491 - 560
SQPPKKVSRVQVVSSLQSSVVEAFNKVLSSVNPVPVYIPNLSPPANAGITLPTRGYKCLECGDSFALEKS    561 - 630
LTQHYDRRSVRIEVTCNHCTKNLVFYNKCSLLSHARGHKEKGVVMQCSHLILKPVPADQMIVSPSSNTST    631 - 700
STSTLQSPVGAGTHTVTKIQSGITGTVISAPSSTPITPAMPLDEDPSKLCRHSLKCLECNEVFQDETSLA    701 - 770
THFQQAADTSGQKTCTICQMLLPNQCSYASHQRIHQHKSPYTCPECGAICRSVHFQTHVTKNCLHYTRRV    771 - 840
GFRCVHCNVVYSDVAALKSHIQGSHCEVFYKCPICPMAFKSAPSTHSHAYTQHPGIKIGEPKIIYKCSMC    841 - 910
DTVFTLQTLLYRHFDQHIENQKVSVFKCPDCSLLYAQKQLMMDHIKSMHGTLKSIEGPPNLGINLPLSIK    911 - 980
PATQNSANQNKEDTKSMNGKEKLEKKSPSPVKKSMETKKVASPGWTCWECDCLFMQRDVYISHVRKEHGK    981 - 1050
QMKKHPCRQCDKSFSSSHSLCRHNRIKHKGIRKVYACSHCPDSRRTFTKRLMLEKHVQLMHGIKDPDLKE   1051 - 1120
MTDATNEEETEIKEDTKVPSPKRKLEEPVLEFRPPRGAITQPLKKLKINVFKVHKCAVCGFTTENLLQFH   1121 - 1190
EHIPQHKSDGSSYQCRECGLCYTSHVSLSRHLFIVHKLKEPQPVSKQNGAGEDNQQENKPSHEDESPDGA   1191 - 1260
VSDRKCKVCAKTFETEAALNTHMRTHGMAFIKSKRMSSAEK                                1261 - 1301
//

Text Mined References (14)

PMID Year Title