Property Summary

NCBI Gene PubMed Count 7
PubMed Score 25.11
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.051 3.4e-02
astrocytic glioma 1.200 1.8e-02
atypical teratoid / rhabdoid tumor -1.400 5.7e-03
Breast cancer 3.200 2.8e-02
cystic fibrosis 1.033 1.1e-04
ductal carcinoma in situ 1.200 2.9e-02
ependymoma -1.200 9.1e-06
glioblastoma -1.400 1.1e-03
interstitial cystitis -1.600 4.6e-04
invasive ductal carcinoma 1.700 5.6e-03
malignant mesothelioma -3.000 2.2e-06
medulloblastoma -1.400 2.0e-02
medulloblastoma, large-cell -2.100 2.4e-03
oligodendroglioma 1.500 9.0e-03
osteosarcoma 1.819 2.1e-04
ovarian cancer 2.200 9.1e-06

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MFRNSLKMLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSGQGGISTESDCAFEPDYAVPPLPVSE      1 - 70
GDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQTSAITQRISPCSTLTSSTAS     71 - 140
PPASSPCSTLPPISTNATAKDCSYGAVTSPTSTLESRDSGIIATLTSYSENVERTKYAGESSKELGSGGN    141 - 210
IKPWQSQKSSMDSCLYRVDENMTASTYSLNKIPERNLETVLSQSVQSIPLYLMPRPNSVAATSSAHLEDL    211 - 280
AYLDEQRHTPLRTSLRMPRQSMGGARTQQDLRVRFAPYRPPDISLKPLLFEVPSITTESVFVGRDWVFHE    281 - 350
IDAQLQSSNASVNQGVVIVGNIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPKHVDANRELPLTQPP    351 - 420
SAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTCLVPEFVHNVAALLCRSPQLTAYRE    421 - 490
QLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIILIDGLNEAEFHKPDYGDTIVS    491 - 560
FLSKMIGKFPSWLKLIVTVRTSLQEITKLLPFHRIFLDRLEENEAIDQDLQAYILHRIHSSSEIQNNISL    561 - 630
NGKMDNTTFGKLSSHLKTLSQGSYLYLKLTFDLIEKGYLVLKSSSYKVVPVSLSEVYLLQCNMKFPTQSS    631 - 700
FDRVMPLLNVAVASLHPLTDEHIFQAINAGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPSFREW    701 - 770
LIWREEGEKTKFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW    771 - 840
ISYSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEMVALLLEFGAN    841 - 910
VDASSESGLTPLGYAAAAGYLSIVVLLCKKRAKVDHLDKNGQCALVHAALRGHLEVVKFLIQCDWTMAGQ    911 - 980
QQGVFKKSHAIQQALIAAASMGYTEIVSYLLDLPEKDEEEVERAQINSFDSLWGETALTAAAGRGKLEVC    981 - 1050
RLLLEQGAAVAQPNRRGAVPLFSTVRQGHWQIVDLLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLL   1051 - 1120
AQGASIALMDKEGLTALSWACLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLVDHGA   1121 - 1190
MIEHVDYSGMRPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFYKKGKV   1191 - 1260
KEAAQRYQYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALELKPKSYEAYYA   1261 - 1330
RARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQPPPPPQPQQQLPEEAEPEPQ   1331 - 1400
HEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVIQSPPSSPPHRDSAYISSSPLGSHQVFDFRS   1401 - 1470
SSSVGSPTRQTYQSTSPALSPTHQNSHYRPSPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGP   1471 - 1540
QYRASPPAESMSVYRSQSGSPVRYQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKA   1541 - 1610
QIVRSNQPSPAVHSSTVIPTGAYGQVAHSMASKYQSSQGDIGVSQSRLVYQGSIGGIVGDGRPVQHVQAS   1611 - 1680
LSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASYYPVCHSKLDLERSSSQLGSPDVSHL   1681 - 1750
IRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFRPSSSIQQMEIPLKPAYERSC   1751 - 1820
DELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPHLHQQNRTWAVSSVDTVLSPTSPGNLPQPES   1821 - 1890
FSPPSSISNIAFYNKTNNAQNGHLLEDDYYSPHGMLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQ   1891 - 1960
DNLYRQLSRDSRQGQTSPIKPKRPFVESNV                                           1961 - 1990
//

Text Mined References (17)

PMID Year Title