Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.76
PubTator Score 154.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.7e-05
group 4 medulloblastoma 1.400 3.6e-06
medulloblastoma, large-cell 1.500 6.2e-06
osteosarcoma -2.189 4.4e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLR      1 - 70
DHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRREGSYDRYLRMDDYCRRK     71 - 140
DDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTK    141 - 210
DYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRN    211 - 280
MPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLA    281 - 350
DNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT    351 - 420
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQASGNQPPSILGQ    421 - 490
GGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQ    491 - 560
TTAQMGQPQAPMGSYQRHY                                                       561 - 579
//

Text Mined References (27)

PMID Year Title