Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 1
Funding $628,077.5
PubMed Score 8.89
PubTator Score 154.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.189 0.000
group 4 medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.500 0.000

Synonym

Accession Q9HCD5 B2RTV9 E1P5R0 Q6HA99 Q9H1F2 Q9H2T2 Q9H4Y9 NCoA-5
Symbols CIA
bA465L10.6

Gene

PANTHER Protein Class (1)

PDB

1V95   2J7X   2J7Y   4ZI1  

Gene RIF (4)

PMID Text
25416054 NCOA5 low expression correlates with survival in esophageal squamous cell carcinoma.
24332041 suggest that NCOA5 is a haploinsufficient tumor suppressor and that NCOA5 deficiency increases susceptibility to both glucose intolerance and HCC, partially by increasing IL-6 expression
21645569 gene polymorphism confers susceptibility to psoriasis in a Southern European population
20650312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDLRDHRHSRDLR      1 - 70
DHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPMYRREGSYDRYLRMDDYCRRK     71 - 140
DDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTK    141 - 210
DYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRN    211 - 280
MPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLA    281 - 350
DNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT    351 - 420
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQASGNQPPSILGQ    421 - 490
GGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSVQKALDTLIQSGPALSHLVSQ    491 - 560
TTAQMGQPQAPMGSYQRHY                                                       561 - 579
//

Text Mined References (26)

PMID Year Title
25416054 2014 NCOA5 low expression correlates with survival in esophageal squamous cell carcinoma.
24332041 2013 NCOA5 haploinsufficiency results in glucose intolerance and subsequent hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21645569 2011 A CD40 and an NCOA5 gene polymorphism confer susceptibility to psoriasis in a Southern European population: a case-control study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...