Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 1.0e-02
Astrocytoma, Pilocytic -1.300 3.7e-04
atypical teratoid / rhabdoid tumor -2.200 3.1e-08
ependymoma -1.600 2.3e-09
gastric cancer 1.100 1.4e-04
glioblastoma -1.300 4.3e-09
group 3 medulloblastoma -1.700 6.4e-04
medulloblastoma, large-cell -2.500 6.6e-05
pituitary cancer -1.500 1.3e-06
primitive neuroectodermal tumor -1.800 1.0e-03

Gene RIF (2)

AA Sequence

MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQDNVLNIINQI      1 - 70
MDECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRG     71 - 140
ALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCETVERALDFGY    141 - 210
LTQDMIDDYEPALMFSIPRLAIVCGLVVYADGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELH    211 - 280
TLERNLCISQDVEFPIRADVQGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVH    281 - 350
RAGDEMSSLLSPPIACQSPAHRPGAEGSPGGEASPGRPRLRSGSDEEERVFFMDDVEGTAEALARPESPA    351 - 420
GPFGWAGSTWADPQEKGQGGPGGAAGISLPASEKEEDLSNNNLEAEGTDGASLAGTSSCSCLDSRLHLDG    421 - 490
WEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPHKLSTGATNCL    491 - 560
LHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLAKASDRAPERQEEAPPPSEDASNGREPKAPT    561 - 630
SDKCLPHTSGSQVDTASGLQGEAGVAGQQEPEARELHAGSPSAHEAPQALSGSSSSTAGSCSSDKMGPEA    631 - 700
APAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKE    701 - 770
KLRKVTQTLRSAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCR    771 - 840
SCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL                           841 - 887
//

Text Mined References (11)

PMID Year Title