Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.09
PubTator Score 4.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-07
ependymoma 4679 2.3e-05
ulcerative colitis 1819 2.5e-04
psoriasis 6694 3.9e-04
cutaneous lupus erythematosus 1057 3.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -3.700 3.0e-03
ependymoma 1.800 2.3e-05
osteosarcoma 1.959 1.9e-07
psoriasis -1.800 3.9e-04
ulcerative colitis -1.300 2.5e-04

Gene RIF (2)

AA Sequence

MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLVLLNDLHNFNE      1 - 70
FLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLHKVLLLLIMLLVAAGLVGLDI     71 - 140
QWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFYRIHRRGPKILLLLLFFGVVLVIYLAPLCIS    141 - 210
SPCIMEPRDLPPKPGLVGHRGAPMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTN    211 - 280
VASVFPTRITAHSSDFSWTELKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNL    281 - 350
SIMFDLRRPPQNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP    351 - 420
QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRYPIWLITPQTY    421 - 490
LIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME                         491 - 539
//

Text Mined References (9)

PMID Year Title