Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.85
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -3.700 0.003
psoriasis -1.800 0.000
osteosarcoma 1.959 0.000
posterior fossa group B ependymoma 2.500 0.000
ulcerative colitis -1.300 0.000

Gene RIF (2)

PMID Text
19596859 GDE3 substrate GroPIns is a candidate mediator for osteoblast proliferation
12933806 GDE3 is a novel seven-transmembrane protein with a GP-PDE-like extracellular motif expressed during osteoblast differentiation that accelerates the program of osteoblast differentiation and is involved in morphological change of cells

AA Sequence

MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLVLLNDLHNFNE      1 - 70
FLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLHKVLLLLIMLLVAAGLVGLDI     71 - 140
QWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFYRIHRRGPKILLLLLFFGVVLVIYLAPLCIS    141 - 210
SPCIMEPRDLPPKPGLVGHRGAPMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTN    211 - 280
VASVFPTRITAHSSDFSWTELKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNL    281 - 350
SIMFDLRRPPQNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP    351 - 420
QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRYPIWLITPQTY    421 - 490
LIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME                         491 - 539
//

Text Mined References (9)

PMID Year Title
19596859 2009 The developmentally regulated osteoblast phosphodiesterase GDE3 is glycerophosphoinositol-specific and modulates cell growth.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12933806 2003 Novel membrane protein containing glycerophosphodiester phosphodiesterase motif is transiently expressed during osteoblast differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.