Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.66
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.400 4.1e-03
atypical teratoid/rhabdoid tumor 1.300 4.9e-04
cystic fibrosis -2.661 2.1e-06
interstitial cystitis -1.100 1.6e-02
intraductal papillary-mucinous adenoma (... -1.200 8.9e-04
juvenile dermatomyositis 1.293 9.7e-12
medulloblastoma, large-cell -1.300 6.3e-03
osteosarcoma 2.284 9.7e-05
pituitary cancer -1.400 1.4e-04
spina bifida -2.172 4.5e-02

Gene RIF (3)

AA Sequence

MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESS      1 - 70
RHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLL     71 - 140
GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQ    141 - 210
GPGGPWRPWLR                                                               211 - 221
//

Text Mined References (11)

PMID Year Title