Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
Funding $275,400
PubMed Score 8.35
PubTator Score 8.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.400 0.004
osteosarcoma 2.284 0.000
cystic fibrosis -2.661 0.000
medulloblastoma, large-cell -1.300 0.006
juvenile dermatomyositis 1.293 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.001
interstitial cystitis -1.300 0.001
atypical teratoid/rhabdoid tumor 1.300 0.000
spina bifida -2.172 0.045
pituitary cancer -1.400 0.000

Gene RIF (2)

PMID Text
25579220 Overexpression and knockdown studies demonstrated that Hes4 promotes osteogenesis resulting in an increase in Runx2, osteocalcin, osteopontin, and bone sialoprotein expression in BMSC.
25480889 Epigenetic dysregulation of HES4 could play a critical role in modifying Huntington's disease pathogenesis and severity.

AA Sequence

MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESS      1 - 70
RHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLL     71 - 140
GHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQ    141 - 210
GPGGPWRPWLR                                                               211 - 221
//

Text Mined References (10)

PMID Year Title
25579220 2015 Novel basic helix-loop-helix transcription factor hes4 antagonizes the function of twist-1 to regulate lineage commitment of bone marrow stromal/stem cells.
25480889 2015 Epigenetic dysregulation of hairy and enhancer of split 4 (HES4) is associated with striatal degeneration in postmortem Huntington brains.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254753 2004 Identification and characterization of human HES2, HES3, and HES5 genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11260262 2001 Hes7: a bHLH-type repressor gene regulated by Notch and expressed in the presomitic mesoderm.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.