Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.54
PubTator Score 65.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.500 9.2e-04
atypical teratoid / rhabdoid tumor 1.400 1.3e-05
Breast cancer 4.000 2.6e-02
breast carcinoma 1.100 2.2e-12
ependymoma 1.200 8.7e-08
glioblastoma 1.100 5.7e-04
interstitial cystitis -1.100 5.4e-04
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-03
invasive ductal carcinoma 1.400 2.6e-03
lung cancer 1.800 4.8e-04
medulloblastoma, large-cell 1.400 4.0e-04
non-small cell lung cancer 1.013 1.1e-14
osteosarcoma 1.929 8.9e-06
pancreatic ductal adenocarcinoma liver m... -1.464 3.8e-03
psoriasis -1.300 2.8e-04

 GWAS Trait (1)

Gene RIF (12)

AA Sequence

MWAVLRLALRPCARASPAGPRAYHGDSVASLGTQPDLGSALYQENYKQMKALVNQLHERVEHIKLGGGEK      1 - 70
ARALHISRGKLLPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGIITGIGRVSGVECMIIANDATV     71 - 140
KGGAYYPVTVKKQLRAQEIAMQNRLPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIA    141 - 210
VVMGSCTAGGAYVPAMADENIIVRKQGTIFLAGPPLVKAATGEEVSAEDLGGADLHCRKSGVSDHWALDD    211 - 280
HHALHLTRKVVRNLNYQKKLDVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAF    281 - 350
YGDTLVTGFARIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAK    351 - 420
DGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAANVLATITKDQR    421 - 490
AREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSFSAALNAPIEKTDFGI    491 - 560
FRM                                                                       561 - 563
//

Text Mined References (28)

PMID Year Title