Property Summary

NCBI Gene PubMed Count 29
PubMed Score 0.00
PubTator Score 31.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
tuberculosis -1.500 4.8e-04
adrenocortical adenoma -1.225 1.1e-02
adrenocortical carcinoma -2.492 4.5e-07
astrocytic glioma 1.200 3.5e-02
atypical teratoid/rhabdoid tumor -1.500 4.9e-03
Breast cancer -1.400 9.9e-06
cystic fibrosis and chronic rhinosinusit... 1.423 3.2e-02
glioblastoma -1.400 6.8e-03
group 4 medulloblastoma 1.500 1.1e-02
intraductal papillary-mucinous adenoma (... -2.900 1.5e-04
intraductal papillary-mucinous carcinoma... -2.600 3.8e-03
intraductal papillary-mucinous neoplasm ... -2.300 3.2e-02
invasive ductal carcinoma -1.100 2.4e-02
lung adenocarcinoma -1.700 2.2e-06
lung cancer -2.300 3.0e-04
lung carcinoma -1.900 1.4e-13
malignant mesothelioma -1.800 1.7e-05
medulloblastoma, large-cell -1.800 8.4e-04
oligodendroglioma 1.300 3.9e-02
osteosarcoma 1.753 1.5e-02
ovarian cancer 2.300 5.1e-05
pancreatic cancer 2.700 6.6e-04
pituitary cancer -1.600 3.2e-02
posterior fossa group A ependymoma -1.100 2.0e-02
primary pancreatic ductal adenocarcinoma 1.990 1.7e-03
psoriasis -3.000 3.4e-04
subependymal giant cell astrocytoma -2.576 3.4e-03
ulcerative colitis -1.153 4.9e-02

Gene RIF (14)

AA Sequence

MRLSPAPLKLSRTPALLALALPLAAALAFSDETLDKVPKSEGYCSRILRAQGTRREGYTEFSLRVEGDPD      1 - 70
FYKPGTSYRVTLSAAPPSYFRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRR     71 - 140
TRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTAKYRLT    141 - 210
FYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVL    211 - 280
TVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDL    281 - 350
IPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPD    351 - 420
NVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCM    421 - 490
GPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKCTVNEECSPSSCL    491 - 560
MTEWGEWDECSATCGMGMKKRHRMIKMNPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTC    561 - 630
GKGMRTRQRMLKSLAELGDCNEDLEQVEKCMLPECPIDCELTEWSQWSECNKSCGKGHVIRTRMIQMEPQ    631 - 700
FGGAPCPETVQRKKCRIRKCLRNPSIQKLRWREARESRRSEQLKEESEGEQFPGCRMRPWTAWSECTKLC    701 - 770
GGGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVHPC                                     771 - 807
//

Text Mined References (30)

PMID Year Title