Property Summary

NCBI Gene PubMed Count 29
PubMed Score 0.00
PubTator Score 31.01

Knowledge Summary


No data available



Accession Q9HCB6 A8K6W5 O94862 Q8NCD7 Q8WUR5
Symbols f-spondin



2ZOT   2ZOU   3COO   3Q13  

Gene RIF (14)

27010727 gene expression experiment revealed that CYP2B6, SPON1, and GSG1L can be activated concomitantly through a constitutive androstane receptor (CAR) activation pathway
26032498 SPON1 promotes metastatic progression through Fak and Src dependent pathway in human osteosarcoma.
24158112 High SPON1 expression is associated with high-grade gliomas.
23535033 These data suggest that SPON1 may be associated with the differential rate of cognitive decline in Alzheimer disease.
23471985 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity
23333304 HIV-1 Vif downregulates the expression of spondin 1 (SPON1, extracellular matrix protein) in Vif-expression T cells
22244873 These findings indicate that F-spondin regulates the differentiation of human cementoblast-like cells via BMP7 expression.
21569239 The unique feature of F-spondin FS domain is the presence of three disulfide bonds associated with the N- and C-termini of the domain and a highly conserved N-linked glycosylation site.
21488757 downregulates osteoclast recruitment to the root side of periodontal tissue via low-density lipoprotein receptor-related protein 8 and inhibits differentiation of osteoclastic precursors
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

GGGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVHPC                                     771 - 807

Text Mined References (30)

PMID Year Title
27010727 2016 Genome-Wide Pharmacogenomic Study on Methadone Maintenance Treatment Identifies SNP rs17180299 and Multiple Haplotypes on CYP2B6, SPON1, and GSG1L Associated with Plasma Concentrations of Methadone R- and S-enantiomers in Heroin-Dependent Patients.
26032498 2015 Spondin 1 promotes metastatic progression through Fak and Src dependent pathway in human osteosarcoma.
24158112 2013 Experimental validation of 5 in-silico predicted glioma biomarkers.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23471985 2013 Genome-wide scan of healthy human connectome discovers SPON1 gene variant influencing dementia severity.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22244873 2012 F-spondin regulates the differentiation of human cementoblast-like (HCEM) cells via BMP7 expression.
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
21569239 2011 The structure of the Ca²+-binding, glycosylated F-spondin domain of F-spondin - A C2-domain variant in an extracellular matrix protein.