Property Summary

Ligand Count 1
NCBI Gene PubMed Count 48
PubMed Score 36.61
PubTator Score 36.81

Knowledge Summary

Patent (5,218)

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.296 4.1e-02
cystic fibrosis 1.018 9.7e-05
ependymoma -1.100 4.9e-02
glioblastoma 1.100 1.3e-04
group 4 medulloblastoma -1.800 7.4e-05
intraductal papillary-mucinous carcinoma... 1.300 6.8e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.7e-02
lung carcinoma -1.700 4.3e-23
medulloblastoma, large-cell -1.700 2.6e-04
oligodendroglioma -1.400 7.6e-03
ovarian cancer 1.800 3.7e-05
pancreatic cancer 1.500 2.1e-03
pancreatic ductal adenocarcinoma liver m... -2.036 1.6e-02
pediatric high grade glioma 1.100 1.4e-03
tuberculosis and treatment for 6 months -1.300 8.1e-06

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKT      1 - 70
VALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQ     71 - 140
KRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGT    141 - 210
PYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRE    211 - 280
LVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST                                         281 - 313
//

Text Mined References (54)

PMID Year Title