Property Summary

NCBI Gene PubMed Count 43
PubMed Score 33.78
PubTator Score 36.81

Knowledge Summary

Patent (5,218)

Expression

Synonym

Accession Q9HC98 B7Z2D9 Q5TBG3 Q5TBG9 Q6FG86 Q6IAR3 Q96E83 Q9ULX2
Symbols SID6-1512

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
26259750 Overexpression of AURKA and NEK6 genes was significantly more pronounced in Ulcerative colitis patients with more extensive colon involvement
25940345 Nek6 facilitates association of Hsp72 with the mitotic spindle, where it promotes stable K-fiber assembly through recruitment of the ch-TOG-TACC3 complex.
25523445 NEK6 suppresses the cell growth arrest induced by TGFbeta. Mechanically, NEK6 blocks nuclear translocation of Smad4, which is essential for TGFbeta function.
24763737 Nek6 is also a critical signaling molecule that helps prevent cardiac hypertrophy and inhibits the Akt signaling pathway.
23416273 Nek6 plays an important role in the premature senescence of cancer cells.
21725899 High Nek6 is associated with hepatic cell cancer.
21642957 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21539811 These results suggest that the increased expression of Nek6 renders cancer cells resistant to premature senescence, and targeting Nek6 could be an efficient strategy for cancer treatment.
21454704 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
21320329 the first low resolution 3D structure of hNek6 protein in solution
More...

AA Sequence

MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKT      1 - 70
VALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQ     71 - 140
KRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGT    141 - 210
PYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRE    211 - 280
LVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST                                         281 - 313
//

Text Mined References (48)

PMID Year Title
26259750 2015 Never in mitosis gene A-related kinase 6 and aurora kinase A: New gene biomarkers in the conversion from ulcerative colitis to colorectal cancer.
25940345 2015 Hsp72 is targeted to the mitotic spindle by Nek6 to promote K-fiber assembly and mitotic progression.
25523445 2015 An inhibitory role of NEK6 in TGF?/Smad signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24763737 2014 Never in mitosis gene A related kinase-6 attenuates pressure overload-induced activation of the protein kinase B pathway and cardiac hypertrophy.
23416273 2013 The inhibition of Nek6 function sensitizes human cancer cells to premature senescence upon serum reduction or anticancer drug treatment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21725899 2012 Clinical and biological significance of never in mitosis gene A-related kinase 6 (NEK6) expression in hepatic cell cancer.
21642957 2011 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21539811 2011 Nek6 suppresses the premature senescence of human cancer cells induced by camptothecin and doxorubicin treatment.
More...