Property Summary

NCBI Gene PubMed Count 22
Grant Count 21
R01 Count 12
Funding $2,295,876.4
PubMed Score 57.64
PubTator Score 39.10

Knowledge Summary

Patent (7,596)

Expression

  Differential Expression (2)

Disease log2 FC p
Barrett's esophagus 1.100 0.036
esophageal adenocarcinoma 1.200 0.018

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
2058 confirmatory 153 / 177 / 291813 Image-Based HTS for Selective Antagonists of GPR35
2079 summary 3 / 0 / 0 Summary of Image-based HTS for Selective Antagonists of GPR35
2338 confirmatory 0 / 0 / 21 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay
2340 confirmatory 0 / 0 / 21 SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay
2480 confirmatory 36 / 0 / 24 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 2
2809 confirmatory 2 / 0 / 36 SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay - Set 2
2815 confirmatory 1 / 0 / 37 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 3
434924 confirmatory 0 / 0 / 39 SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay - Set 3
434925 confirmatory 0 / 0 / 39 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 4
463217 confirmatory 20 / 0 / 10 SAR Analysis for the identification of Selective Antagonists of ERK1/2 Activity in GPR35-Overexpressing U2OS Cells
463227 confirmatory 10 / 0 / 4 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 5
485283 confirmatory 1 / 0 / 64 SAR analysis of Antagonists of the GPR35 Receptor using an Image-Based Assay - Set 6
485286 confirmatory 0 / 0 / 65 SAR analysis of Agonists of the GPR35 Receptor using an Image-Based Assay - Set 4
488987 confirmatory 4 / 0 / 1 SAR Analysis for the identification of Selective Antagonists of ERK1/2 Activity in GPR35-Overexpressing U2OS Cells - Set 2
588503 confirmatory 10 / 0 / 41 SAR analysis of small molecule NTR1 agonists in a image based GPR35 selectivity assay

Gene RIF (10)

PMID Text
25489960 Single-nucleotide polymorphism in GPR35 gene is associated with Crohn's disease.
25411203 This article shows that GPR35 is the receptor of CXCL17.
24347166 results clearly show that R4.60, R(164), R(167), and R6.58 play crucial roles in the agonist initiated activation of GPR35.
22821403 GPR35 shows associations in both ulcerative colitis (UC) and primary sclerosing cholangitis (PSC), whereas TCF4 represents a PSC risk locus not associated with UC. Both loci may represent previously unexplored aspects of PSC pathogenesis.
22820167 This review presents a summary of what is known about the G-protein coupled receptors GPR35 and GPR55 and their potential characterization as lysophospholipid or cannabinoid receptors, respectively--{REVIEW}
20919992 screening assays used to identification of small MW agonists; some compounds are species-specific agonists; agonists/ligands include zaprinast, cromolyn & dicumarol
20599711 human iNKT cells express GPR35 functionally active in reducing IL-4 release.
20361937 These results strongly suggest that 2-acyl lysophosphatidic acid is an endogenous ligand for GPR35.
18271057 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17940199 The results of the study demonstrate the coupling of GPR35 to endogenous G proteins that modulate neuronal Ca2+ channel and thereby provide evidence for a potential role of GPR35 in regulating neuronal excitability and synaptic transmission

AA Sequence

MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLL      1 - 70
CTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVL     71 - 140
WVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAE    141 - 210
ATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMA    211 - 280
KEFQEASALAVAPSAKAHKSQDSLCVTLA                                             281 - 309
//

Text Mined References (24)

PMID Year Title
25489960 2015 Immunochip analysis identification of 6 additional susceptibility loci for Crohn's disease in Koreans.
25411203 2015 Cutting edge: GPR35/CXCR8 is the receptor of the mucosal chemokine CXCL17.
24699281 2014 Genetic signatures for enhanced olfaction in the African mole-rats.
24347166 2014 Crucial positively charged residues for ligand activation of the GPR35 receptor.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22821403 2013 Genome-wide association analysis in primary sclerosing cholangitis and ulcerative colitis identifies risk loci at GPR35 and TCF4.
22820167 2013 GPR55 and GPR35 and their relationship to cannabinoid and lysophospholipid receptors.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20919992 2010 Identification of novel species-selective agonists of the G-protein-coupled receptor GPR35 that promote recruitment of ?-arrestin-2 and activate G?13.
20599711 2010 Expression of functional GPR35 in human iNKT cells.
20361937 2010 GPR35 is a novel lysophosphatidic acid receptor.
18271057 2008 Application of machine learning algorithms to predict coronary artery calcification with a sibship-based design.
17940199 2008 Inhibition of N-type calcium channels by activation of GPR35, an orphan receptor, heterologously expressed in rat sympathetic neurons.
16754668 2006 Kynurenic acid as a ligand for orphan G protein-coupled receptor GPR35.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14965362 2004 Cloning of a G-protein-coupled receptor that shows an activity to transform NIH3T3 cells and is expressed in gastric cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11017071 2000 Genetic variation in the gene encoding calpain-10 is associated with type 2 diabetes mellitus.
9479505 1998 Discovery of three novel G-protein-coupled receptor genes.
947955 1976 Human bone marrow lymphocytes. Cytotoxic effector cells in the bone marrow of normal individuals.