Property Summary

Ligand Count 31
NCBI Gene PubMed Count 24
PubMed Score 64.15
PubTator Score 39.10

Knowledge Summary

Patent (7,596)

Expression

  Differential Expression (2)

Disease log2 FC p
Barrett's esophagus 1.100 3.6e-02
esophageal adenocarcinoma 1.200 1.8e-02

Protein-protein Interaction (5)

Gene RIF (12)

AA Sequence

MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLL      1 - 70
CTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVL     71 - 140
WVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAE    141 - 210
ATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMA    211 - 280
KEFQEASALAVAPSAKAHKSQDSLCVTLA                                             281 - 309
//

Text Mined References (26)

PMID Year Title