Property Summary

NCBI Gene PubMed Count 146
Grant Count 49
R01 Count 35
Funding $6,592,401.53
PubMed Score 193.50
PubTator Score 267.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 0.006

Gene RIF (191)

PMID Text
26376770 due to its association with androgen excess in phenotype A, CAPN 10 gene polymorphism UCSNP-43 could be used as a genetic marker for CVD in young PCOS women.
25982606 SNP-63 and indel-19 variant of the CAPN10 gene do not represent a risk factor for polycystic ovary syndrome in Mexican women of reproductive age.
25867367 Data indicate no association between calpain 10 (CAPN10) polymorphisms and type 2 diabetes mellitus.
25773692 Different mutations in CAPN10 have already been found in three independent Iranian families
25617558 SNP-19 in CAPN10 may participate in the development of diabetes mellitus type 2
25504243 Genotype I/I of SNP19 in CAPN10 was significantly associated with excess weight in Colombian patients 10-18 years of age even those with physically active lifestyles.
25382134 genetic association studies in Asian populations: Data suggest that an SNP in CAPN10 (SNP43 G>A, rs3792267) is associated with type 2 diabetes in Asian populations, especially in Chinese populations. [META-ANALYSIS]
25327507 The present study provides the first observation of an association between a variant in CAPN10 gene and the response to metformin therapy in patients with type 2 diabetes
25238846 Subjects with the GG genotype of the rs2975762 variant of the CAPN10 gene were better responders to dietary intervention, showing increased HDL-C concentrations from the first month of treatment
24993116 This work confirms the association of CAPN10 gene with metabolic components in PCOS and highlights the role of haplotypes as strong and efficient genetic markers.
More...

AA Sequence

MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDPREGQVKQGLL      1 - 70
GDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWVEVTTDDRLPCLAGRLCFSRC     71 - 140
QREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQ    141 - 210
LLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEG    211 - 280
WSQVDAAVASELLSQLQEGEFWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQ    281 - 350
SAGGCRNNSGFPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV    351 - 420
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGEFLLRVFSTGR    421 - 490
VSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRIT    491 - 560
LHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPLLSCVPHRYAQEVSRLCLLPAGTYKVVPSTY    561 - 630
LPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSIMAVMKT                                631 - 672
//

Text Mined References (148)

PMID Year Title
26376770 2015 Association of Calpain (CAPN) 10 (UCSNP-43, rs3792267) gene polymorphism with elevated serum androgens in young women with the most severe phenotype of polycystic ovary syndrome (PCOS).
25982606 [Association analysis of SNP-63 and indel-19 variant in the calpain-10 gene with polycystic ovary syndrome in women of reproductive age].
25867367 2015 Calpain-10 gene polymorphisms and risk of type 2 diabetes mellitus in Mexican mestizos.
25773692 2015 New evidence for the role of calpain 10 in autosomal recessive intellectual disability: identification of two novel nonsense variants by exome sequencing in Iranian families.
25617558 2014 [SNP-19 genotypic variants of CAPN10 gene and its relation to diabetes mellitus type 2 in a population of Ciudad Juarez, Mexico].
25504243 Variant in CAPN10 gene and environmental factors show evidence of association with excess weight among young people in a Colombian population.
25382134 2015 CAPN10 SNP43 G>A gene polymorphism and type 2 diabetes mellitus in the Asian population: a meta-analysis of 9353 participants.
25327507 2015 A pharmacogenetic association between a variation in calpain 10 (CAPN10) gene and the response to metformin treatment in patients with type 2 diabetes.
25238846 2014 A genetic variant of the CAPN10 gene in Mexican subjects with dyslipidemia is associated with increased HDL-cholesterol concentrations after the consumption of a soy protein and soluble fiber dietary portfolio.
24993116 2014 Common polymorphisms of calpain-10 and the risk of polycystic ovary syndrome in Tunisian population: a case-control study.
More...