Property Summary

NCBI Gene PubMed Count 151
PubMed Score 197.77
PubTator Score 267.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 6.4e-03

 GWAS Trait (1)

Gene RIF (196)

AA Sequence

MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDPREGQVKQGLL      1 - 70
GDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWVEVTTDDRLPCLAGRLCFSRC     71 - 140
QREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQ    141 - 210
LLHLKDQCLISCCVLSPRAGARELGEFHAFIVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEG    211 - 280
WSQVDAAVASELLSQLQEGEFWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQ    281 - 350
SAGGCRNNSGFPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV    351 - 420
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGEFLLRVFSTGR    421 - 490
VSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRIT    491 - 560
LHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPLLSCVPHRYAQEVSRLCLLPAGTYKVVPSTY    561 - 630
LPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSIMAVMKT                                631 - 672
//

Text Mined References (153)

PMID Year Title