Property Summary

NCBI Gene PubMed Count 27
Grant Count 11
R01 Count 9
Funding $2,563,751
PubMed Score 123.52
PubTator Score 23.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
25311537 important role for ZBTB20 in controlling NSCLC development
25062845 3q13.31 microdeletion-based dosage imbalance of ZBTB20 linked to a range of neurodevelopmental, cognitive and psychiatric disorders, likely mediated by dysregulation of multiple ZBTB20 target genes.
25017102 Missense mutations in ZBTB20 underlie Primrose syndrome.
24694013 Major depressive disorder is associated with significant hypermethylation within the coding region of ZBTB20.
23861218 Polymorphism in ZBTB20 gene is associated with gastric cancer.
23283686 This study disclosed Zbtb20-mediated transcriptional repressor mechanism may be involved in development of the human archicortex.
22037551 We identified new susceptibility loci for non-cardia gastric cancer at 3q13.31: rs9841504 in ZBTB20
21702992 ZBTB20 mRNA & protein expression were elevated significantly in HCC tissues compared with the paired non-tumor tissues & normal liver. HCC recurrence or metastasis increased & disease-free survival decreased with high ZBTB20 expression.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MLERKKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPDPALIHSTHSLTNSHAHTGSSDCDIS      1 - 70
CKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKLLLGYSDI     71 - 140
EIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIVSQNVGDVFPGIQDSGQD    141 - 210
TPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPRDH    211 - 280
HMEDPSWITRIHERSQQMERYLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILER    281 - 350
NESEECTEDTDQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGPGAARDSQAEPTQPEQAAEAPAEGG    351 - 420
PQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMP    421 - 490
LTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPL    491 - 560
ASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTGEKPHQCSICWRSFSLKDYLIKHMVTHTG    561 - 630
VRAYQCSICNKRFTQKSSLNVHMRLHRGEKSYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGAR    631 - 700
AGPPGVVACTEGTTYVCSVCPAKFDQIEQFNDHMRMHVSDG                                 701 - 741
//

Text Mined References (36)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25311537 2014 Zinc finger protein ZBTB20 promotes cell proliferation in non-small cell lung cancer through repression of FoxO1.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25062845 2014 Neurodevelopmental disorders associated with dosage imbalance of ZBTB20 correlate with the morbidity spectrum of ZBTB20 candidate target genes.
25017102 2014 Mutations in ZBTB20 cause Primrose syndrome.
24694013 2014 Hypermethylation in the ZBTB20 gene is associated with major depressive disorder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...