Property Summary

NCBI Gene PubMed Count 58
PubMed Score 57.06
PubTator Score 1370.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
malignant mesothelioma 3163 1.84930380750208E-7
osteosarcoma 7933 3.26327248045274E-6
psoriasis 6685 5.23972172910516E-6
ovarian cancer 8492 1.06040864245137E-5
Pick disease 1893 2.38386951474082E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.51000004867852E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00176175879945673
pilocytic astrocytoma 3086 0.00294597864603005
ependymoma 2514 0.00357800254512445
colon cancer 1475 0.00616295558784282
progressive supranuclear palsy 674 0.00804800366183512
glioblastoma 5572 0.0100406858535468
adrenocortical carcinoma 1427 0.0153257542102337
group 3 medulloblastoma 2254 0.0252147597061521
gastric carcinoma 832 0.0257440030281426
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Microcephaly 149 5.747 2.9
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Obstructive sleep apnea 28 3.885 1.9
Central sleep apnea 12 3.044 1.5

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
psoriasis -3.400 0.000
osteosarcoma -2.553 0.000
ependymoma -1.100 0.004
glioblastoma -1.300 0.010
adrenocortical carcinoma 1.082 0.015
intraductal papillary-mucinous carcinoma... 1.800 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.002
colon cancer 1.100 0.006
group 3 medulloblastoma 1.200 0.025
pilocytic astrocytoma -1.200 0.003
Pick disease -1.500 0.000
progressive supranuclear palsy -1.300 0.008
gastric carcinoma 1.300 0.026
ovarian cancer 1.400 0.000

Synonym

Accession Q9HC77 Q2KHM6 Q5JPD5 Q5T6R5 Q96KS5 Q9C067 CENP-J
Symbols LAP
CPAP
LIP1
BM032
MCPH6
SASS4
SCKL4
Sas-4
CENP-J

Gene

PANTHER Protein Class (1)

PDB

5ITZ  

  Ortholog (11)

Gene RIF (34)

PMID Text
26929011 CPAP promotes timely cilium disassembly to maintain neural progenitor pool. CPAP mutation causes Seckel syndrome with microcephaly.
26517891 Data suggest that the single G-box domain (that appears to fold into 14-20 antiparallel beta-strands) of CENPJ has stable but dynamic structure; CRAP forms multimers (in solution and in crystals) of elongated fibrils similar to amyloid fibrils. [REVIEW]
25616662 Centrobin plays a role in the stability and centriole elongation function of CPAP and limits the centriole length.
24700465 Centrobin-CPAP interaction is critical for the recruitment of CPAP to procentrioles to promote the elongation of daughter centrioles and for the persistence of CPAP on preexisting mother centrioles.
24491538 CPAP depletion results in asymmetric spindle poles with uneven distribution of pericentriolar material.
24385583 Sas-4 acts as a vehicle to tether PCM complexes to centrioles independent of its well-known role in centriole duplication
24288161 The results showed a human-specific hypomethylation in the 5' UTR of CENPJ in the brain, where methylation levels among humans are only about one-third of those found among nonhuman primates.
24052813 studies provide the first structural insight into how the malfunction of centriole proteins results in human disease and also reveal that the CPAP-STIL interaction constitutes a conserved key step in centriole biogenesis
23857771 CEP120 is a CPAP-interacting protein that positively regulates centriole elongation.
23810536 CEP120 associates with SPICE1 and CPAP, and depletion of any of these proteins results in short procentrioles. Furthermore, CEP120 or CPAP overexpression results in excessive centriole elongation, a process dependent on CEP120, SPICE1, and CPAP.
More...

AA Sequence

MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADKEKRAAVDISTSFPIKGTHFSDSFSFINE      1 - 70
EDSLLEEQKLESNNPYKPQSDKSETHTAFPCIKKGPQVAACHSAPGHQEENKNDFIPDLASEFKEGAYKD     71 - 140
PLFKKLEQLKEVQQKKQEQLKRQQLEQLQRLMEEQEKLLTMVSGQCTLPGLSLLPDDQSQKHRSPGNTTT    141 - 210
GERATCCFPSYVYPDPTQEETYPSNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLK    211 - 280
EENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIGERKQTFEDYLEEQIQLEE    281 - 350
QELKQKQLKEAEGPLPIKAKPKQPFLKRGEGLARFTNAKSKFQKGKESKLVTNQSTSEDQPLFKMDRQQL    351 - 420
QRKTALKNKELCADNPILKKDSKARTKSGSVTLSQKPKMLKCSNRKSLSPSGLKIQTGKKCDGQFRDQIK    421 - 490
FENKVTSNNKENVTECPKPCDTGCTGWNKTQGKDRLPLSTGPASRLAAKSPIRETMKESESSLDVSLQKK    491 - 560
LETWEREKEKENLELDEFLFLEQAADEISFSSNSSFVLKILERDQQICKGHRMSSTPVKAVPQKTNPADP    561 - 630
ISHCNRSEDLDHTAREKESECEVAPKQLHSLSSADELREQPCKIRKAVQKSTSENQTEWNARDDEGVPNS    631 - 700
DSSTDSEEQLDVTIKPSTEDRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIM    701 - 770
ESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKR    771 - 840
KIAPVKRGEDLSKSRRSRSPPTSELMMKFFPSLKPKPKSDSHLGNELKLNISQDQPPGDNARSQVLREKI    841 - 910
IELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKY    911 - 980
TTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL    981 - 1050
DAWKRAEAIESSLEVEKKDKLANTSVRFQNSQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGNLDK   1051 - 1120
GQAASPREPLEPLNFPDPEYKEEEEDQDIQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITV   1121 - 1190
TFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQ   1191 - 1260
EESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEG   1261 - 1330
NVLMDTEL                                                                 1331 - 1338
//

Text Mined References (61)

PMID Year Title
26929011 2016 CPAP promotes timely cilium disassembly to maintain neural progenitor pool.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26517891 2015 The centriolar protein CPAP G-box: an amyloid fibril in a single domain.
25616662 2015 Centrobin-mediated regulation of the centrosomal protein 4.1-associated protein (CPAP) level limits centriole length during elongation stage.
25385835 2015 RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
24700465 2014 Centrobin-centrosomal protein 4.1-associated protein (CPAP) interaction promotes CPAP localization to the centrioles during centriole duplication.
24491538 2014 Asymmetric spindle pole formation in CPAP-depleted mitotic cells.
24385583 2014 Conserved TCP domain of Sas-4/CPAP is essential for pericentriolar material tethering during centrosome biogenesis.
24288161 2014 Human-specific hypomethylation of CENPJ, a key brain size regulator.
24052813 2013 Crystal structures of the CPAP/STIL complex reveal its role in centriole assembly and human microcephaly.
More...