Property Summary

NCBI Gene PubMed Count 60
PubMed Score 58.97
PubTator Score 1370.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma 1.082 1.5e-02
Astrocytoma, Pilocytic -1.100 3.2e-03
colon cancer 1.100 6.2e-03
ependymoma -1.100 3.6e-03
gastric carcinoma 1.300 2.6e-02
glioblastoma -1.300 1.0e-02
group 3 medulloblastoma 1.200 2.5e-02
intraductal papillary-mucinous carcinoma... 1.800 4.5e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-03
malignant mesothelioma 1.900 1.8e-07
osteosarcoma -2.097 1.4e-04
ovarian cancer 1.400 1.1e-05
Pick disease -1.500 2.4e-05
progressive supranuclear palsy -1.300 8.0e-03
psoriasis -3.400 5.2e-06

Gene RIF (35)

AA Sequence

MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADKEKRAAVDISTSFPIKGTHFSDSFSFINE      1 - 70
EDSLLEEQKLESNNPYKPQSDKSETHTAFPCIKKGPQVAACHSAPGHQEENKNDFIPDLASEFKEGAYKD     71 - 140
PLFKKLEQLKEVQQKKQEQLKRQQLEQLQRLMEEQEKLLTMVSGQCTLPGLSLLPDDQSQKHRSPGNTTT    141 - 210
GERATCCFPSYVYPDPTQEETYPSNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLK    211 - 280
EENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIGERKQTFEDYLEEQIQLEE    281 - 350
QELKQKQLKEAEGPLPIKAKPKQPFLKRGEGLARFTNAKSKFQKGKESKLVTNQSTSEDQPLFKMDRQQL    351 - 420
QRKTALKNKELCADNPILKKDSKARTKSGSVTLSQKPKMLKCSNRKSLSPSGLKIQTGKKCDGQFRDQIK    421 - 490
FENKVTSNNKENVTECPKPCDTGCTGWNKTQGKDRLPLSTGPASRLAAKSPIRETMKESESSLDVSLQKK    491 - 560
LETWEREKEKENLELDEFLFLEQAADEISFSSNSSFVLKILERDQQICKGHRMSSTPVKAVPQKTNPADP    561 - 630
ISHCNRSEDLDHTAREKESECEVAPKQLHSLSSADELREQPCKIRKAVQKSTSENQTEWNARDDEGVPNS    631 - 700
DSSTDSEEQLDVTIKPSTEDRERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIM    701 - 770
ESIKHKVSEPSRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKR    771 - 840
KIAPVKRGEDLSKSRRSRSPPTSELMMKFFPSLKPKPKSDSHLGNELKLNISQDQPPGDNARSQVLREKI    841 - 910
IELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIEEFKKEEMRKLQKERKVFEKY    911 - 980
TTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSSTHSRLRSQIQMLVRENTDLREEIKVMERFRL    981 - 1050
DAWKRAEAIESSLEVEKKDKLANTSVRFQNSQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGNLDK   1051 - 1120
GQAASPREPLEPLNFPDPEYKEEEEDQDIQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITV   1121 - 1190
TFFNGDVKQVMPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQ   1191 - 1260
EESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRSGRIRVKDKEG   1261 - 1330
NVLMDTEL                                                                 1331 - 1338
//

Text Mined References (64)

PMID Year Title