Property Summary

NCBI Gene PubMed Count 50
Grant Count 63
R01 Count 36
Funding $6,646,439.78
PubMed Score 67.89
PubTator Score 79.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
tuberculosis -3.300 0.000
psoriasis 1.300 0.000

Synonym

Accession Q9HC73 J3QKD1 Q5G7M1 Q9H5R3
Symbols CRL2
TSLPR
CRLF2Y

Gene

Gene RIF (45)

PMID Text
26754556 In adult B-cell acute lymphoblastic leukemia without recurrent fusion genes , high CRLF2 expression is associated with distinct clinico-biological features and an unfavourable prognosis
26288354 CD4+ T cells from atopic dermatitis patients directly interacted with TSLP to produce a higher amount of IL-4 than those from normal subjects, and this action was attenuated with anti-TSLPR antibody
25676453 The levels of mRNA for TSLP and TSLPR were significantly elevated in parotid gland tissues from the KD group as compared to the control group.
25044358 Differences exist in the genetic profiles of Down syndrome-associated acute lymphoblastic leukemia patients in Japan and in Western countries, and that P2RY8-CRLF2 and EBF1 deletions may cooperate in leukemogenesis in a subset of Japanese DS-ALL patients.
24935070 CRLF2 overexpression (OE) was detected in 30 (18%) of 167 patients, the P2RY8-CRLF2 fusion was identified in only 3 (1.8%) of 167 patients, all of which demonstrated CRLF2 OE.
24787007 we report noncysteine in-frame mutations in IL7R and CRLF2 located in a region of the transmembrane domain closer to the cytosolic domain in acute lymphoblastic leukemias
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of cytokine receptor-like factor 2 (CRLF2) in primary human brain microvascular endothelial cells
24356513 The TSLPR in blood plateltes promotes platelet activation via activating the PI3K/AKT pathway.
24231528 Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases.
24018820 both IKZF1 deletions and IGH@-CRLF2 are associated with an increased risk of treatment failure in adult acute lymphoblastic leukemia
More...

AA Sequence

MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQ      1 - 70
CTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSD     71 - 140
LSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQ    141 - 210
RGEIRDACAETPTPPKPKLSKFILISSLAILLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQ    211 - 280
GNFQEWITDTQNVAHLHKMAGAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQG    281 - 350
GDVVTIGGFTFVMNDRSYVAL                                                     351 - 371
//

Text Mined References (51)

PMID Year Title
26754556 2016 CRLF2 overexpression identifies an unfavourable subgroup of adult B-cell precursor acute lymphoblastic leukemia lacking recurrent genetic abnormalities.
26288354 2015 TSLP Directly Interacts with Skin-Homing Th2 Cells Highly Expressing its Receptor to Enhance IL-4 Production in Atopic Dermatitis.
25676453 2015 Increased expression of thymic stromal lymphopoietin and its receptor in Kimura's disease.
25044358 2014 Gene alterations involving the CRLF2-JAK pathway and recurrent gene deletions in Down syndrome-associated acute lymphoblastic leukemia in Japan.
24935070 2014 An overall characterization of pediatric acute lymphoblastic leukemia with CRLF2 overexpression.
24787007 2014 Novel activating mutations lacking cysteine in type I cytokine receptors in acute lymphoblastic leukemia.
24356513 2013 Human platelets express functional thymic stromal lymphopoietin receptors: a potential role in platelet activation in acute coronary syndrome.
24231528 2014 Significance of CD66c expression in childhood acute lymphoblastic leukemia.
24018820 2013 Unravelling the prognostic effect of IKZF1 deletions and IGH@-CRLF2 in adult acute lymphoblastic leukaemia.
23974192 2013 Independent prognostic value of BCR-ABL1-like signature and IKZF1 deletion, but not high CRLF2 expression, in children with B-cell precursor ALL.
More...