Property Summary

NCBI Gene PubMed Count 55
PubMed Score 78.70
PubTator Score 79.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 4.3e-05
psoriasis 1.300 7.0e-29
tuberculosis -3.300 3.8e-09

Gene RIF (49)

AA Sequence

MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQ      1 - 70
CTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSD     71 - 140
LSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQ    141 - 210
RGEIRDACAETPTPPKPKLSKFILISSLAILLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQ    211 - 280
GNFQEWITDTQNVAHLHKMAGAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQG    281 - 350
GDVVTIGGFTFVMNDRSYVAL                                                     351 - 371
//

Text Mined References (56)

PMID Year Title