Property Summary

NCBI Gene PubMed Count 42
PubMed Score 1.43
PubTator Score 30.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.200 1.0e-03
atypical teratoid / rhabdoid tumor -1.600 9.1e-07
glioblastoma -1.700 6.4e-06
malignant mesothelioma 1.300 2.7e-06
medulloblastoma -1.300 1.2e-05
medulloblastoma, large-cell -1.500 6.4e-06
non-small cell lung cancer 1.239 1.1e-12
osteosarcoma 1.915 2.4e-05
ovarian cancer -1.200 6.7e-07
subependymal giant cell astrocytoma -1.362 8.9e-03

Protein-protein Interaction (2)

Gene RIF (25)

AA Sequence

MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVKNSLYNAASLF      1 - 70
GFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRD     71 - 140
QPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQK    141 - 210
EEREKYRKLLERLKESGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRG    211 - 280
PLCSLRSEKRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKE    281 - 350
KNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM    351 - 420
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKC    421 - 490
LKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYIS    491 - 560
RDKPITFTQHQMPLFRKKMVWEILHQQLL                                             561 - 589
//

Text Mined References (47)

PMID Year Title