Property Summary

NCBI Gene PubMed Count 40
Grant Count 10
R01 Count 9
Funding $1,353,608.9
PubMed Score 1.43
PubTator Score 30.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -2.124 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.700 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.500 0.000
non-small cell lung cancer 1.239 0.000
pediatric high grade glioma -1.200 0.000
subependymal giant cell astrocytoma -1.362 0.009
ovarian cancer -1.200 0.000

Gene RIF (23)

PMID Text
26369384 SENP2 inhibits MMP13 expression in BC cells through de-SUMOylation of TBL1/TBLR1, which inhibits nuclear translocation of beta-catenin.
25784542 data identify SENP2 as an important regulator of fatty acid metabolism in skeletal muscle
25689261 p90RSK-mediated SENP2-T368 phosphorylation is a master switch in disturbed-flow-induced signaling.
25633526 miR-181b targets SENP2 and positively regulated NF-kappaB activity. NF-kappaB activation by DNA damage in GBM cells confers resistance to radiation-induced death.
25483061 SENP2 regulates the transcriptional function of MEF2A via direct de-SUMOylation.
24969559 we show that WWOX required for stabilization of beta-catenin regulated by SENP2 in hepatocellular carcinoma cells
24422630 ESR1 repression by SENP2 is independent of its SUMO protease activity.
24196834 Many nucleoporins are mislocalized and, in some cases, reduced in level when SENP1 and SENP2 are codepleted.
24048451 Chromosome segregation depends on precise spatial and temporal control of sumoylation in mitosis; SENP1 and SENP2 are important mediators of this control.
24008762 SENP2 inhibited bladder cancer cells migration and invasion by regulating the expression of MMP13.
More...

AA Sequence

MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVKNSLYNAASLF      1 - 70
GFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRD     71 - 140
QPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQK    141 - 210
EEREKYRKLLERLKESGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRG    211 - 280
PLCSLRSEKRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKE    281 - 350
KNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM    351 - 420
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKC    421 - 490
LKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYIS    491 - 560
RDKPITFTQHQMPLFRKKMVWEILHQQLL                                             561 - 589
//

Text Mined References (45)

PMID Year Title
26369384 2015 SENP2 regulates MMP13 expression in a bladder cancer cell line through SUMOylation of TBL1/TBLR1.
25784542 2015 SUMO-Specific Protease 2 (SENP2) Is an Important Regulator of Fatty Acid Metabolism in Skeletal Muscle.
25689261 2015 Disturbed flow-activated p90RSK kinase accelerates atherosclerosis by inhibiting SENP2 function.
25633526 2015 DNA damage-induced NF-?B activation in human glioblastoma cells promotes miR-181b expression and cell proliferation.
25483061 2014 The E3 ligase APC/C-Cdh1 regulates MEF2A-dependent transcription by targeting SUMO-specific protease 2 for ubiquitination and degradation.
25416956 2014 A proteome-scale map of the human interactome network.
24969559 2014 SENP2 regulated the stability of ?-catenin through WWOX in hepatocellular carcinoma cell.
24422630 2014 Transcriptional repression of estrogen receptor ? signaling by SENP2 in breast cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196834 2014 The SUMO proteases SENP1 and SENP2 play a critical role in nucleoporin homeostasis and nuclear pore complex function.
More...