Property Summary

NCBI Gene PubMed Count 20
PubMed Score 87.91
PubTator Score 54.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical adenoma -2.190 3.0e-03
adrenocortical carcinoma -3.351 9.8e-11
adult high grade glioma -1.100 4.3e-02
astrocytic glioma -1.600 5.1e-03
atypical teratoid / rhabdoid tumor -1.800 3.7e-05
colon cancer -2.000 4.2e-02
Endometriosis 1.064 4.5e-02
ependymoma -2.000 9.5e-04
glioblastoma -1.800 3.5e-04
group 3 medulloblastoma -1.700 3.4e-02
lung adenocarcinoma -1.337 6.9e-06
lung cancer -1.600 4.6e-03
medulloblastoma, large-cell -1.800 2.7e-03
nephrosclerosis 1.007 1.7e-03
non-small cell lung cancer -1.803 8.0e-14
oligodendroglioma -1.400 1.9e-02
osteosarcoma 1.929 3.2e-02
ovarian cancer 1.100 2.5e-10
Pick disease -1.200 4.0e-04
primitive neuroectodermal tumor -1.600 3.1e-02
subependymal giant cell astrocytoma -2.361 5.5e-03
urothelial carcinoma 2.100 5.6e-03

Gene RIF (10)

AA Sequence

MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP      1 - 70
RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ     71 - 140
AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE    141 - 210
PGRGQQKHFQ                                                                211 - 220
//

Text Mined References (21)

PMID Year Title