Property Summary

NCBI Gene PubMed Count 19
PubMed Score 81.98
PubTator Score 54.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
non-small cell lung cancer 2798 8.03841532003252E-14
adrenocortical carcinoma 1427 9.81406885258629E-11
ovarian cancer 8492 2.51362768202032E-10
lung adenocarcinoma 2714 6.90487395742984E-6
atypical teratoid / rhabdoid tumor 4369 3.74872790842235E-5
sonic hedgehog group medulloblastoma 1482 2.97202526285674E-4
glioblastoma 5572 3.50902203808555E-4
Pick disease 1893 3.9582070630424E-4
ependymoma 2514 9.50058181934205E-4
nephrosclerosis 329 0.00172789024122672
medulloblastoma, large-cell 6234 0.00274740680198253
adrenocortical adenoma 134 0.00301294933622599
lung cancer 4473 0.00463068272450641
astrocytic glioma 2241 0.0050564041663559
subependymal giant cell astrocytoma 2287 0.00553965316131553
urothelial carcinoma 318 0.00562422130966798
oligodendroglioma 2849 0.0192424540668216
primitive neuroectodermal tumor 3031 0.030902665796689
osteosarcoma 7933 0.0318271552246008
colon cancer 1475 0.0423436590105532
adult high grade glioma 2148 0.0433835002696451
Endometriosis 535 0.045076021669607
Disease Target Count Z-score Confidence
Ocular hypotension 7 3.766 1.9
Hypochondriasis 7 3.195 1.6
Asthma 349 3.151 1.6

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis 1.007 0.002
urothelial carcinoma 2.100 0.006
astrocytic glioma -1.600 0.005
ependymoma -2.000 0.001
oligodendroglioma -1.400 0.019
glioblastoma -1.800 0.000
osteosarcoma 1.929 0.032
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.800 0.003
primitive neuroectodermal tumor -1.600 0.031
adrenocortical adenoma -2.190 0.003
adrenocortical carcinoma -3.351 0.000
non-small cell lung cancer -1.803 0.000
lung cancer -1.600 0.005
colon cancer -2.000 0.042
adult high grade glioma -1.100 0.043
subependymal giant cell astrocytoma -2.361 0.006
lung adenocarcinoma -1.337 0.000
Endometriosis 1.064 0.045
Pick disease -1.200 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q9HC57 D3DUL7 Q8NC27 Q9HAU1
Symbols PS20

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
21545747 HIV-1 virus transfer among primary CD4+ T-lymphocytes was promoted by ectopic ps20 expression or by exogenous addition of recombinant ps20.
20090771 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19488830 suggests that the tumor suppressive function of WFDC1 may be partially a result of up-regulated Dkk1 gene expression, which is known to be a potent inhibitor of the Wnt signaling pathway
19460752 Knockdown of WAP four-disulfide core domain 1 (WFDC1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18842679 data suggest an important role for WFDC1 in inhibiting proliferation of both tumors and senescent cells. Finally, we suggest that the downregulation of WFDC1 might serve as a biomarker for cellular transformation
18842679 our data suggest an important role for WFDC1 in inhibiting proliferation of both tumors and senescent cells
17942534 ps20 promoted HIV entry via fusion and augmented CD54 integrin expression
15305342 WFDC1/ps20 is down regulated but not frequently mutated in prostate cancer. It is expressed predominantly in the normal prostatic stroma. It might play a role in the maintenance of the normal extra cellular matrix milieu in the prostate.
12032731 results suggest a minor role, if any, of WFDC1 in hepatocarcinogenesis

AA Sequence

MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP      1 - 70
RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ     71 - 140
AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE    141 - 210
PGRGQQKHFQ                                                                211 - 220
//

Text Mined References (20)

PMID Year Title
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23502471 2013 PAX2 Expression in Ovarian Cancer.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21936833 2011 The WFDC1 gene: role in wound response and tissue homoeostasis.
21936828 2011 Immunotherapy of prostate cancer: identification of new treatments and targets for therapy, and role of WAP domain-containing proteins.
21936827 2011 War and peace between WAP and HIV: role of SLPI, trappin-2, elafin and ps20 in susceptibility to HIV infection.
21545747 2011 WFDC1 expression identifies memory CD4 T-lymphocytes rendered vulnerable to cell-cell HIV-1 transfer by promoting intercellular adhesive junctions.
20090771 2010 Supervised machine learning and logistic regression identifies novel epistatic risk factors with PTPN22 for rheumatoid arthritis.
19488830 2009 Expression and functional analysis of the WAP four disulfide core domain 1 gene in human melanoma.
18842679 2009 Modulated expression of WFDC1 during carcinogenesis and cellular senescence.
More...