Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 7
Funding $1,162,909
PubMed Score 81.98
PubTator Score 54.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
nephrosclerosis 1.007 0.002
urothelial carcinoma 2.100 0.006
astrocytic glioma -1.600 0.005
ependymoma -2.000 0.001
oligodendroglioma -1.400 0.019
glioblastoma -1.800 0.000
osteosarcoma 1.929 0.032
sonic hedgehog group medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.800 0.003
primitive neuroectodermal tumor -1.600 0.031
adrenocortical adenoma -2.190 0.003
adrenocortical carcinoma -3.351 0.000
non-small cell lung cancer -1.803 0.000
lung cancer -1.600 0.005
colon cancer -2.000 0.042
adult high grade glioma -1.100 0.043
subependymal giant cell astrocytoma -2.361 0.006
lung adenocarcinoma -1.337 0.000
Endometriosis 1.064 0.045
Pick disease -1.200 0.000
ovarian cancer 1.100 0.000

Gene RIF (9)

PMID Text
21545747 HIV-1 virus transfer among primary CD4+ T-lymphocytes was promoted by ectopic ps20 expression or by exogenous addition of recombinant ps20.
20090771 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19488830 suggests that the tumor suppressive function of WFDC1 may be partially a result of up-regulated Dkk1 gene expression, which is known to be a potent inhibitor of the Wnt signaling pathway
19460752 Knockdown of WAP four-disulfide core domain 1 (WFDC1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18842679 data suggest an important role for WFDC1 in inhibiting proliferation of both tumors and senescent cells. Finally, we suggest that the downregulation of WFDC1 might serve as a biomarker for cellular transformation
18842679 our data suggest an important role for WFDC1 in inhibiting proliferation of both tumors and senescent cells
17942534 ps20 promoted HIV entry via fusion and augmented CD54 integrin expression
15305342 WFDC1/ps20 is down regulated but not frequently mutated in prostate cancer. It is expressed predominantly in the normal prostatic stroma. It might play a role in the maintenance of the normal extra cellular matrix milieu in the prostate.
12032731 results suggest a minor role, if any, of WFDC1 in hepatocarcinogenesis

AA Sequence

MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPP      1 - 70
RTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQ     71 - 140
AEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAE    141 - 210
PGRGQQKHFQ                                                                211 - 220
//

Text Mined References (20)

PMID Year Title
24376456 2013 Gene-alcohol interactions identify several novel blood pressure loci including a promising locus near SLC16A9.
23502471 2013 PAX2 Expression in Ovarian Cancer.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21936833 2011 The WFDC1 gene: role in wound response and tissue homoeostasis.
21936828 2011 Immunotherapy of prostate cancer: identification of new treatments and targets for therapy, and role of WAP domain-containing proteins.
21936827 2011 War and peace between WAP and HIV: role of SLPI, trappin-2, elafin and ps20 in susceptibility to HIV infection.
21545747 2011 WFDC1 expression identifies memory CD4 T-lymphocytes rendered vulnerable to cell-cell HIV-1 transfer by promoting intercellular adhesive junctions.
20090771 2010 Supervised machine learning and logistic regression identifies novel epistatic risk factors with PTPN22 for rheumatoid arthritis.
19488830 2009 Expression and functional analysis of the WAP four disulfide core domain 1 gene in human melanoma.
18842679 2009 Modulated expression of WFDC1 during carcinogenesis and cellular senescence.
More...