Property Summary

NCBI Gene PubMed Count 20
PubMed Score 14.21
PubTator Score 8.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Autism spectrum disorder 101 3.237 1.6
Disease Target Count
Autism Spectrum Disorders 75
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 1.0

Expression

  Differential Expression (32)

Disease log2 FC p
adrenocortical adenoma -1.453 1.3e-06
adrenocortical carcinoma -1.360 1.2e-02
adult high grade glioma -2.000 2.0e-04
astrocytoma -1.100 5.0e-09
atypical teratoid / rhabdoid tumor -2.400 3.0e-02
Breast cancer -1.500 1.7e-09
breast carcinoma -1.100 4.0e-03
colon cancer -1.700 7.0e-04
cystic fibrosis 1.366 1.6e-05
ductal carcinoma in situ -3.100 1.4e-04
ependymoma -2.100 2.5e-07
fibroadenoma -1.600 2.3e-02
glioblastoma -1.600 3.8e-04
group 3 medulloblastoma -2.000 3.8e-03
intraductal papillary-mucinous adenoma (... -1.600 2.6e-03
intraductal papillary-mucinous carcinoma... -1.500 4.0e-02
intraductal papillary-mucinous neoplasm ... -1.800 1.3e-02
invasive ductal carcinoma -3.600 6.0e-04
lung adenocarcinoma -1.300 2.2e-10
lung cancer -1.400 4.2e-04
lung carcinoma 2.200 1.6e-09
malignant mesothelioma -2.900 7.4e-08
medulloblastoma, large-cell -2.100 2.1e-05
non-small cell lung cancer -2.312 3.2e-21
oligodendroglioma -1.300 2.2e-07
osteosarcoma 1.963 9.5e-03
ovarian cancer -3.900 4.1e-16
Pick disease 1.400 3.5e-02
primitive neuroectodermal tumor -1.900 2.7e-02
psoriasis -1.100 1.0e-05
subependymal giant cell astrocytoma -1.179 4.7e-02
tuberculosis 1.400 2.9e-04

Protein-protein Interaction (7)

Gene RIF (7)

AA Sequence

MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKA      1 - 70
GDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAP     71 - 140
MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNL    141 - 210
DREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDAD    211 - 280
IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTD    281 - 350
VNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL    351 - 420
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT    421 - 490
ISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIV    491 - 560
TVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSN    561 - 630
VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEV    631 - 700
FAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLV    701 - 770
FLYVNDTAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH    771 - 840
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPINGTISLPAEL    841 - 910
EEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTL    911 - 980
SKRSSTSSDHFSASECSSQGGFKTKGPLHTRQCNSHSKSDNIPVTPQKCPSSTGFHIQENEESHYESQRR    981 - 1050
VTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPR   1051 - 1120
GLAEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRN   1121 - 1190
QFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL                          1191 - 1237
//

Text Mined References (22)

PMID Year Title