Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 5
Funding $469,074.17
PubMed Score 11.34
PubTator Score 8.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Gene RIF (6)

PMID Text
25869928 Loss of PCDH9 is associated with the differentiation of tumor cells and metastasis in gastric cancer
25172662 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3beta in hepatocellular carcinoma.
22300792 Our results suggest that PCDH9 might function as a tumor suppressor during cancer development and progression
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKA      1 - 70
GDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAP     71 - 140
MFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNL    141 - 210
DREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDAD    211 - 280
IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTD    281 - 350
VNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL    351 - 420
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT    421 - 490
ISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIV    491 - 560
TVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSN    561 - 630
VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEV    631 - 700
FAVDVDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLV    701 - 770
FLYVNDTAGNASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH    771 - 840
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPINGTISLPAEL    841 - 910
EEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKKHHVIQELPLDNTFVGGCDTL    911 - 980
SKRSSTSSDHFSASECSSQGGFKTKGPLHTRQCNSHSKSDNIPVTPQKCPSSTGFHIQENEESHYESQRR    981 - 1050
VTFHLPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPR   1051 - 1120
GLAEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRN   1121 - 1190
QFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL                          1191 - 1237
//

Text Mined References (22)

PMID Year Title
25869928 2015 Loss of PCDH9 is associated with the differentiation of tumor cells and metastasis and predicts poor survival in gastric cancer.
25172662 2014 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3? in hepatocellular carcinoma.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22633400 2012 Genome-wide association study identifies candidate genes for male fertility traits in humans.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22300792 2012 Downregulation of PCDH9 predicts prognosis for patients with glioma.
21844884 2013 Genome-wide meta-analysis identifies variants associated with platinating agent susceptibility across populations.
21552555 2011 A genome-wide association study on obesity and obesity-related traits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...