Property Summary

Ligand Count 3
NCBI Gene PubMed Count 33
PubMed Score 183.43
PubTator Score 1111.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 1.7e-03
Disease Target Count Z-score Confidence
Conversion disorder 6 3.344 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer 1.500 1.7e-03

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (13)

AA Sequence

MELSAVGERVFAAEALLKRRIRKGRMEYLVKWKGWSQKYSTWEPEENILDARLLAAFEEREREMELYGPK      1 - 70
KRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRAREGLRNMGLSPPASSTSTSS     71 - 140
TCRAEAPRDRDRDRDRDRERDRERERERERERERERERERGTSRVDDKPSSPGDSSKKRGPKPRKELPDP    141 - 210
SQRPLGEPSAGLGEYLKGRKLDDTPSGAGKFPAGHSVIQLARRQDSDLVQCGVTSPSSAEATGKLAVDTF    211 - 280
PARVIKHRAAFLEAKGQGALDPNGTRVRHGSGPPSSGGGLYRDMGAQGGRPSLIARIPVARILGDPEEES    281 - 350
WSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR                                   351 - 389
//

Text Mined References (41)

PMID Year Title