Property Summary

NCBI Gene PubMed Count 25
PubMed Score 171.60
PubTator Score 1111.57

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 0.00173806060536551
Disease Target Count Z-score Confidence
Conversion disorder 7 3.448 1.7


  Differential Expression (1)

Disease log2 FC p
lung cancer 1.500 0.002


Accession Q9HC52 Q96H39 Q9NR07
Symbols PC3



2N4Q   3I91   5EQ0  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 MGI Term (1)

Gene RIF (9)

26837964 The difference in the SUZ12 and CBX8 genes expression were significantly divergent between tumors and their marginal tissues.
26718407 These data suggest that CBX8 modulates SIPS through the RB-E2F1 pathway in CML cells and provide important insight into its application in CML treatment.
25360999 Low CBX8 expression was associated with distant metastasis in colorectal cancer.
25197352 CBX8 might emerge as an oncogene for promoting the proliferation of tumor cells and raising the resistance of neoplasms to chemotherapy.
24460908 The presence of CBX8-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
23891621 Interaction with CBX8 precludes AF9-DOT1L binding.
23474493 CBX8 cooperated with SIRT1 for suppressing p53 acetylation induced by Sirtinol and etoposide/TSA. Upon ectopic expression, CBX8 or SIRT1 repressed the expression of p21(WAF1) by inhibiting p53 binding to the promoter.
22094252 CBX8 plays an essential role in MLL-AF9 transcriptional regulation and leukemogenesis.
17332741 CBX8 is an essential component of one of the polycomb repressive complexes, which directly regulate the expression of numerous target genes, including the INK4A-ARF locus, involved in cell-fate decisions.

AA Sequence

WSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR                                   351 - 389

Text Mined References (33)

PMID Year Title
26837964 Evaluating of suppressor of zeste 12 and chromobox homolog 8 genes expression showed two possible origins for gastric cancer development.
26718407 2016 CBX8 antagonizes the effect of Sirtinol on premature senescence through the AKT-RB-E2F1 pathway in K562 leukemia cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25360999 2014 Paradoxical role of CBX8 in proliferation and metastasis of colorectal cancer.
25197352 2014 CBX8, a novel DNA repair protein, promotes tumorigenesis in human esophageal carcinoma.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23891621 2013 CBX8, a component of the Polycomb PRC1 complex, modulates DOT1L-mediated gene expression through AF9/MLLT3.
23474493 2013 CBX8 suppresses Sirtinol-induced premature senescence in human breast cancer cells via cooperation with SIRT1.