Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
24850846 SYCP1, cTAGE1, and GTSF1 are expressed in cutaneous T-cell lymphoma, but not in normal skin or benign inflammatory dermatoses.
22752306 Loss of TSC2 in the brain correlates with survival and abnormal behavior.
12839582 cTAGE-1 and cTAGE-5 are new cancer germline antigens and that tumor-specific splicing of cTAGE genes may lead to further candidate proteins for specific immunotherapy of cutaneous T cell lymphoma and other malignancies.

AA Sequence

MFVIISLHNCVVISFVLFLFGGNNFIQNFYLPQNYIDQFLLTSFPTFTSVGVLIVLVLCSAFLLLWQGEG      1 - 70
VNLR                                                                       71 - 74
//

Text Mined References (7)

PMID Year Title
24850846 2014 Ectopic expression of cancer-testis antigens in cutaneous T-cell lymphoma patients.
22752306 2012 Graded loss of tuberin in an allelic series of brain models of TSC correlates with survival, and biochemical, histological and behavioral features.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
12839582 2003 cTAGE: a cutaneous T cell lymphoma associated antigen family with tumor-specific splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
11149944 2001 Serological detection of cutaneous T-cell lymphoma-associated antigens.