Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.118 5.0e-03
astrocytic glioma 1.800 3.1e-03
ependymoma 2.000 7.6e-03
intraductal papillary-mucinous carcinoma... 1.400 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 1.3e-03
oligodendroglioma 1.100 2.2e-02
osteosarcoma 3.038 3.1e-07
ovarian cancer -1.200 6.3e-07
Pick disease 1.300 6.4e-05
pituitary cancer -1.500 7.3e-03
psoriasis -2.100 1.1e-04
sonic hedgehog group medulloblastoma 1.100 1.1e-02
tuberculosis and treatment for 6 months 1.100 3.0e-04

AA Sequence

MAQHDFVPAWLNFSTPQSAKSPTATFEKHGEHLPRGEGRFGVSRRRHNSSDGFFNNGPLRTAGDSWHQPS      1 - 70
LFRHDSVDSGVSKGAYAGITGNPSGWHSSSRGHDGMSQRSGGGTGNHRHWNGSFHSRKGCAFQEKPPMEI     71 - 140
REEKKEDKVEKLQFEEEDFPSLNPEAGKQHQPCRPIGTPSGVWENPPSAKQPSKMLVIKKVSKEDPAAAF    141 - 210
SAAFTSPGSHHANGNKLSSVVPSVYKNLVPKPVPPPSKPNAWKANRMEHKSGSLSSSRESAFTSPISVTK    211 - 280
PVVLASGAALSSPKESPSSTTPPIEISSSRLTKLTRRTTDRKSEFLKTLKDDRNGDFSENRDCDKLEDLE    281 - 350
DNSTPEPKENGEEGCHQNGLALPVVEEGEVLSHSLEAEHRLLKAMGWQEYPENDENCLPLTEDELKEFHM    351 - 420
KTEQLRRNGFGKNGFLQSRSSSLFSPWRSTCKAEFEDSDTETSSSETSDDDAWK                    421 - 474
//

Text Mined References (13)

PMID Year Title