Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 6.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.50585838054642E-6
psoriasis 6685 2.37292275906875E-4
Pick disease 1893 0.00184841925921089
group 3 medulloblastoma 2254 0.00398219209889366
Waldenstrons macroglobulinemia 765 0.00919646198401225
gastric carcinoma 832 0.0140925555585475
Disease Target Count Z-score Confidence
Situs Inversus 52 3.157 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.028 0.009
psoriasis 1.700 0.000
group 3 medulloblastoma 1.300 0.004
Pick disease -1.100 0.002
gastric carcinoma -1.100 0.014
ovarian cancer 2.300 0.000

Synonym

Accession Q9HC38 D3DTG9 D3DTH1 Q96B89 Q9H3J8 Q9HC37 Q9NVN1
Symbols HC71
CGI-150
C17orf25

Gene

PDB

3ZI1  

  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSDYTRITEDSFSKPYDGKWSK      1 - 70
TMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKF     71 - 140
YLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDH    141 - 210
AAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELS    211 - 280
KMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG                                         281 - 313
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...