Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 6.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.4e-04
Pick disease 1894 1.8e-03
group 3 medulloblastoma 4104 4.0e-03
ovarian cancer 8520 5.0e-03
Waldenstrons macroglobulinemia 765 9.2e-03
gastric carcinoma 807 1.4e-02
Disease Target Count Z-score Confidence
Situs Inversus 65 3.095 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
gastric carcinoma -1.100 1.4e-02
group 3 medulloblastoma 1.300 4.0e-03
ovarian cancer -1.300 5.0e-03
Pick disease -1.100 1.8e-03
psoriasis 1.700 2.4e-04
Waldenstrons macroglobulinemia 1.028 9.2e-03

Gene RIF (1)

AA Sequence

MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSDYTRITEDSFSKPYDGKWSK      1 - 70
TMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKF     71 - 140
YLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDH    141 - 210
AAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELS    211 - 280
KMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG                                         281 - 313
//

Text Mined References (17)

PMID Year Title