Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.17
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 4.0e-07
ovarian cancer 8520 2.5e-06
pancreatic cancer 2398 9.3e-04

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.500 4.0e-07
ovarian cancer 1.400 2.5e-06
pancreatic cancer -1.100 9.3e-04

Gene RIF (4)

AA Sequence

MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRKAPSEASAQEQ      1 - 70
REKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQGKILLEGRRLISDALKAGAV     71 - 140
PKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLVTPQGIMGIFAKPDHVKMTYPKTQLQHSLPL    141 - 210
LLICDNLRDPGNLGTILRSAAGAGCSKVLLTKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPP    211 - 280
DTRVYVADNCGLYAQAEMSNKASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAP    281 - 350
AAVVIGGETYGVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRGRAEDLSRDRSYH    351 - 420
//

Text Mined References (18)

PMID Year Title