Property Summary

NCBI Gene PubMed Count 64
Grant Count 14
R01 Count 7
Funding $1,432,152.85
PubMed Score 184.08
PubTator Score 197.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.031
psoriasis -1.300 0.001
osteosarcoma 3.807 0.000
ependymoma 1.100 0.000
glioblastoma 1.600 0.000
group 3 medulloblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
medulloblastoma, large-cell 2.900 0.000
primitive neuroectodermal tumor 1.400 0.000
tuberculosis -1.400 0.000
Breast cancer 2.500 0.040
pediatric high grade glioma 1.300 0.001
aldosterone-producing adenoma -1.145 0.014
ovarian cancer -2.000 0.000
Gaucher disease type 1 -1.800 0.014

Gene RIF (50)

PMID Text
26755435 This review describes the biology of EML4 and ALK, explains the main features of EML4-ALK fusion proteins and outline the therapies that target EML4-ALK in cancer. [review]
26544515 Data suggest that platelets are a valuable source for the non-invasive detection of echinoderm microtubule associated protein like 4-anaplastic lymphoma kinase (EML4-ALK) rearrangements and for predicting and monitoring outcome to crizotinib.
26517679 Data show that inhibition of echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK)-mediated stem-like properties enhances the anti-tumor effect.
26019170 We further showed that both EML4-ALK and mutant forms of EGFR modulate PD-L1 expression via common downstream pathways mediated by MEK-ERK and by PI3K-AKT.
25789526 In the absence of EML4, NUDC was no longer able to localize to the mitotic spindle, whereas NUDC was dispensable for EML4 localization.
25740311 We have determined crystal structures of the coiled-coils from EML2 and EML4, which describe the structural basis of both EML self-association and oncogenic EML4-ALK activation.
25735977 H1299 NSCLC cells stably expressing EML4-ALK acquire epithelial-mesenchymal transition (EMT) phenotype, associated with enhanced invasive migration and increased expression of EMT-inducing transcription factors.
25721120 The FISH-based method of detecting EML4-ALK rearrangement in lung cancer may miss a significant number of patients who could benefit from targeted ALK therapy. IHC should be strongly considered, and NGS is recommended in borderline cases.
25706305 It was revealed that the EML4-ALK fusion gene was observed predominantly in adenocarcinoma, non-smoking and non-small-cell lung cancers (NSCLC) patients, especially those diagnosed in the advanced clinical stage of NSCLC.
25144242 Results suggested that chromothripsis may be a mechanism of oncogenic rearrangement of EML4-ALK.
More...

AA Sequence

MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVASVKKSVSSKG      1 - 70
QPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQ     71 - 140
IRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWENSDDSRNKLSKIPSTPKLIPKVTK    141 - 210
TADKHKDVIINQEGEYIKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLP    211 - 280
TGKIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVT    281 - 350
LSTLQIIGLGTFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPT    351 - 420
DANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPT    421 - 490
PGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE    491 - 560
GKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTR    561 - 630
LVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIY    631 - 700
LYVVSENGRKYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTT    701 - 770
YTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV    771 - 840
SFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETA    841 - 910
EEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLEDQQDPSPS    911 - 980
S//

Text Mined References (73)

PMID Year Title
26755435 2016 Molecular mechanisms that underpin EML4-ALK driven cancers and their response to targeted drugs.
26544515 2016 Rearranged EML4-ALK fusion transcripts sequester in circulating blood platelets and enable blood-based crizotinib response monitoring in non-small-cell lung cancer.
26517679 2015 Targeting stemness is an effective strategy to control EML4-ALK+ non-small cell lung cancer cells.
26019170 2015 Induction of PD-L1 Expression by the EML4-ALK Oncoprotein and Downstream Signaling Pathways in Non-Small Cell Lung Cancer.
25789526 2015 EML4 promotes the loading of NUDC to the spindle for mitotic progression.
25740311 2015 Microtubule association of EML proteins and the EML4-ALK variant 3 oncoprotein require an N-terminal trimerization domain.
25735977 2015 EML4-ALK induces epithelial-mesenchymal transition consistent with cancer stem cell properties in H1299 non-small cell lung cancer cells.
25721120 2015 Fluorescence in situ hybridization, immunohistochemistry, and next-generation sequencing for detection of EML4-ALK rearrangement in lung cancer.
25706305 2015 Clinicopathological characteristics of patients with non-small-cell lung cancer who harbor EML4-ALK fusion gene: a meta-analysis.
25581823 2015 In vivo imaging models of bone and brain metastases and pleural carcinomatosis with a novel human EML4-ALK lung cancer cell line.
More...