Property Summary

NCBI Gene PubMed Count 74
PubMed Score 197.48
PubTator Score 197.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.145 1.4e-02
atypical teratoid / rhabdoid tumor 1.800 1.2e-05
Breast cancer 2.500 4.0e-02
ependymoma 1.100 1.5e-04
Gaucher disease type 1 -1.800 1.4e-02
glioblastoma 1.200 7.0e-05
group 3 medulloblastoma 1.600 1.6e-03
medulloblastoma, large-cell 2.900 4.7e-06
osteosarcoma 2.513 6.6e-05
ovarian cancer -2.000 4.0e-06
pediatric high grade glioma 1.300 8.1e-04
primitive neuroectodermal tumor 1.400 4.8e-04
psoriasis -1.300 5.2e-04
Rheumatoid arthritis 1.100 3.1e-02
tuberculosis -1.200 3.0e-06

Gene RIF (60)

AA Sequence

MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVASVKKSVSSKG      1 - 70
QPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQ     71 - 140
IRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWENSDDSRNKLSKIPSTPKLIPKVTK    141 - 210
TADKHKDVIINQEGEYIKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLP    211 - 280
TGKIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVT    281 - 350
LSTLQIIGLGTFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPT    351 - 420
DANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPT    421 - 490
PGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE    491 - 560
GKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTR    561 - 630
LVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIY    631 - 700
LYVVSENGRKYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTT    701 - 770
YTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV    771 - 840
SFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETA    841 - 910
EEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLEDQQDPSPS    911 - 980
S//

Text Mined References (83)

PMID Year Title