Property Summary

Ligand Count 11
NCBI Gene PubMed Count 832
PubMed Score 1445.51
PubTator Score 1555.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count
Osteosarcoma of bone 6
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Crohn's disease 321 7.965 4.0
Gastrointestinal system disease 54 0.0 3.0

Expression

  Differential Expression (9)

Disease log2 FC p
ulcerative colitis 1.200 4.2e-04
Atopic dermatitis 1.300 1.2e-04
esophageal adenocarcinoma -1.100 3.6e-02
interstitial cystitis 1.200 3.1e-03
malignant mesothelioma -1.400 3.2e-06
osteosarcoma -2.880 7.7e-05
ovarian cancer 1.200 9.5e-06
posterior fossa group A ependymoma 1.300 2.7e-04
psoriasis 1.700 4.0e-10

Gene RIF (963)

AA Sequence

MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWED      1 - 70
YEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPA     71 - 140
IVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPL    141 - 210
ALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEE    211 - 280
LFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLF    281 - 350
EHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR    351 - 420
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSW    421 - 490
MVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGM    491 - 560
CCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLF    561 - 630
NCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKAL    631 - 700
LRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLT    701 - 770
FCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL    771 - 840
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNR    841 - 910
VGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLK    911 - 980
KNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL              981 - 1040
//

Text Mined References (837)

PMID Year Title