Property Summary

NCBI Gene PubMed Count 789
Grant Count 439
R01 Count 222
Funding $44,617,309.34
PubMed Score 1371.92
PubTator Score 1555.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ulcerative colitis 1.200 0.000
malignant mesothelioma -1.400 0.000
esophageal adenocarcinoma -1.100 0.036
psoriasis 1.900 0.000
osteosarcoma -2.880 0.000
Atopic dermatitis 1.300 0.000
interstitial cystitis 1.200 0.003
posterior fossa group A ependymoma 1.300 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9HC29 E2JEQ6 Q96RH5 Q96RH6 Q96RH8
Symbols CD
ACUG
BLAU
IBD1
NLRC2
NOD2B
CARD15
CLR16.3
PSORAS1

Gene

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1566 confirmatory 1839 / 0 / 290647 uHTS luminescence assay for the identification of compounds that inhibit NOD2
1579 summary 0 / 0 / 1 Summary assay for the identification of compounds that inhibit NOD2
2001 confirmatory 263 / 0 / 282 uHTS luminescence assay for the identification of compounds that inhibit NOD2 in MDP treated cells
2334 confirmatory 46 / 0 / 92 SAR analysis of compounds that inhibit NOD2 revised
2475 confirmatory 14 / 0 / 6 SAR analysis of compounds that inhibit NOD2 - Set 2
2799 confirmatory 10 / 0 / 30 SAR analysis of compounds that inhibit NOD2 - Set 3
624267 screening 1387 / 0 / 362744 Fluorescence-based cell-based primary high throughput screening assay to identify inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
624283 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
624370 screening 859 / 0 / 363 Fluorescence-based cell-based high throughput confirmation assay for inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
651553 confirmatory 193 / 0 / 39 Fluorescence-based cell-based high throughput dose response assay for inhibitors of the interaction of nucleotide-binding oligomerization domain containing 2 (NOD2) and the receptor-interacting serine-threonine kinase 2 (RIPK2)
More...

Gene RIF (924)

PMID Text
27050483 CaSR-induced constitutive macropinocytosis facilitates the sentinel function of macrophages, promoting the efficient delivery of ligands to cytosolic pattern-recognition receptors.
27007849 NOD1 and NOD2, two members of the NOD-like receptor family of pattern recognition receptors, are important mediators of ER-stress-induced inflammation in mouse and human cells
26752466 Increased Expression of NOD2 is associated with Inflammatory Bowel Disease.
26752461 NOD2 Loss-of-Function Mutations are associated with Necrotizing Enterocolitis and Focal Intestinal Perforation.
26606664 This is the first description of gonosomal NOD2 mosaicism as the cause of intrafamilial recurrence of Blau syndrome.
26562405 The INCA trial (impact of NOD2 genotype-guided antibiotic prevention on survival in patients with liver cirrhosis and ascites): precision medicine for patients with liver cirrhosis and ascites
26517420 Blau syndrome has been strongly associated with mutations in the NOD2 gene. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201507-1344LE#.VrgfNNL2byA
26316104 Significant associations were found between Crohn's disease (CD) and minor NOD2 variants, as well as TLR4 299Gly, TNF-alpha G-308A, IL-6 G-174C and IL-1RN VNTR A2 variants, while ulcerative colitis (UC) was associated only with IL-1RN VNTR A2 variants.
26238283 the rs2066847 variant of the NOD2/CARD15 gene is not associated with lung cancer risk in the Turkish population
26235265 The genetic variants in the NOD2 is closely associated with leprosy is Chinese population.
More...

AA Sequence

MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWLLSWEVLSWED      1 - 70
YEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPA     71 - 140
IVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQRARRLLDLATVKANGLAAFLLQHVQELPVPL    141 - 210
ALPLEAATCKKYMAKLRTTVSAQSRFLSTYDGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEE    211 - 280
LFSTPGHLNDDADTVLVVGEAGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLF    281 - 350
EHCCWPDVGQEDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR    351 - 420
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALHGLCHLPVFSW    421 - 490
MVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLLRGRLPTLLHLGRLALWGLGM    491 - 560
CCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLEFLHITFQCFFAAFYLALSADVPPALLRHLF    561 - 630
NCGRPGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKAL    631 - 700
LRRQACARWCLARSLRKHFHSIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLT    701 - 770
FCSVGPTECAALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL    771 - 840
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTSLQFLGFWGNR    841 - 910
VGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEELCLEENHLQDEGVCSLAEGLK    911 - 980
KNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRGNTFSLEEVDKLGCRDTRLLL              981 - 1040
//

Text Mined References (795)

PMID Year Title
27050483 2016 Calcium-sensing receptors signal constitutive macropinocytosis and facilitate the uptake of NOD2 ligands in macrophages.
27007849 2016 NOD1 and NOD2 signalling links ER stress with inflammation.
26752466 2016 NOD2 Is Regulated By Mir-320 in Physiological Conditions but this Control Is Altered in Inflamed Tissues of Patients with Inflammatory Bowel Disease.
26752461 2016 NOD2 Loss-of-Function Mutations and Risks of Necrotizing Enterocolitis or Focal Intestinal Perforation in Very Low-birth-weight Infants.
26606664 2016 Brief Report: First Identification of Intrafamilial Recurrence of Blau Syndrome due to Gonosomal NOD2 Mosaicism.
26562405 2015 [The INCA trial (impact of NOD2 genotype-guided antibiotic prevention on survival in patients with liver cirrhosis and ascites): precision medicine for patients with liver cirrhosis and ascites].
26517420 2015 Role of NOD2 Pathway Genes in Sarcoidosis Cases with Clinical Characteristics of Blau Syndrome.
26316104 2015 Variations in inflammatory genes as molecular markers for prediction of inflammatory bowel disease occurrence.
26238283 2015 The role of NOD1/CARD4 and NOD2/CARD15 genetic variations in lung cancer risk.
26235265 2016 Association between genetic variants in NOD2, C13orf31, and CCDC122 genes and leprosy among the Chinese Yi population.
More...